BYKdb

Annotate results for A0A1F0CJ44

A0A1F0CJ44 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1F0CJ44
DOMAINcd41/227TSVREGEGKSTASTSLALSLAQAGFKTLLIDADTRNSVMSGTFKATGTIKGLTNYLSGNA
DLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVNESVATYGDYGN
YGKRDRK
SITEWalker A48/50GKS
SITEWalker A'68/75LLIDADTR
SITEWalker B149/155IIIDTPP
SITEY Cluster215/221YGDYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTRLEIVDSKLRQAKKTEEYFNAIRTNIQFSGKENKILAITSVREGEGKSTASTSLALSLAQAGFKTLLIDADTRNSVMS
                                        TSVREGEGKSTASTSLALSLAQAGFKTLLIDADTRNSVMS
                                               GKS                 LLIDADTR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
GTFKATGTIKGLTNYLSGNADLGDIICETNVPRLMVVPSGKVPPNPTALLQNAYFNKMIEAIKNIFDYIIIDTPPIGLVV
                                                                    IIIDTPP     
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVNESVATYGDYGNYGKRDRKRK
DAAIIANACDGFILVTQAGRIKRNYVEKAKEQMEQSGSKFLGIILNKVNESVATYGDYGNYGKRDRK  
                                                      YGDYGNY        
© 1998-2020Legal notice