BYKdb

Annotate results for A0A1E9ZW15

A0A1E9ZW15 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E9ZW15
DOMAINtad14/250DEIDFGQQLHNLWLHKSKIATALIAGGLLGAVFSFASTPVYRADAMLEIETKQNQILSEI
NNMLSNEPAPSEAEIELVQSRMVIGKTVDELQLDQEVKATYFPVFGNMVHNLSGNDDPIL
KIGTFTVSEEWINKPFKLTVKDSKNYILTLPNGTAKEGRVGTPLKINNETVLKVDQILAE
TDQDFELTKFSKLSAIENIKNQLSVISKGKTSPIINLAYTDVDPKKTSAVLNSIADN
DOMAINcd530/718TGAAPEAGKSFISANLATVMAQSGKRVLLIDTDMRKGYLDQLFKLTPEYGLADILSGHAS
PAKAVCETHIENLHLISNGGYPKNPSELLMDSRFTELLTHAQKRYDYVIIDTPPVLAVTD
STIVGQHAGTVLLVSRYGNTTTRELEISADRLRQNKINIKGVILNGMKREANSMYDYYAY
HSPQDGKKP
SITEWalker A537/539GKS
SITEWalker A'557/564LLIDTDMR
SITEWalker B637/643VIIDTPP
SITE-634/-636YDY
SITEY Cluster704/709YDYYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MYKQYPSSASSNNDEIDFGQQLHNLWLHKSKIATALIAGGLLGAVFSFASTPVYRADAMLEIETKQNQILSEINNMLSNE
             DEIDFGQQLHNLWLHKSKIATALIAGGLLGAVFSFASTPVYRADAMLEIETKQNQILSEINNMLSNE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PAPSEAEIELVQSRMVIGKTVDELQLDQEVKATYFPVFGNMVHNLSGNDDPILKIGTFTVSEEWINKPFKLTVKDSKNYI
PAPSEAEIELVQSRMVIGKTVDELQLDQEVKATYFPVFGNMVHNLSGNDDPILKIGTFTVSEEWINKPFKLTVKDSKNYI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTLPNGTAKEGRVGTPLKINNETVLKVDQILAETDQDFELTKFSKLSAIENIKNQLSVISKGKTSPIINLAYTDVDPKKT
LTLPNGTAKEGRVGTPLKINNETVLKVDQILAETDQDFELTKFSKLSAIENIKNQLSVISKGKTSPIINLAYTDVDPKKT

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAVLNSIADNYVAQNRERDIQVASSGLAFISEELPRLKETLQEAENKLNAYRERAGSLDIPLESKGALESLTSIETQITL
SAVLNSIADN                                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKTEEAGLAELYTPEHPSYKAVLDKLAVLERAKSKINQQIAGLPNTQQEVIRLTRDVETNQATYVQLLAKQQELNIMKAS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQGNVRVVDHAYTPEQPIAPRKAVITALSALAAGALASMWVMLQGRMRRGITSSEEIENLNLEVAALVPYSKTQQKRDLL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRKFKSLNGRSNYLLANEDASDVAVEAIRALRTNIYFSMLDARNNVLMITGAAPEAGKSFISANLATVMAQSGKRVLLID
                                                 TGAAPEAGKSFISANLATVMAQSGKRVLLID
                                                        GKS                 LLID
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDMRKGYLDQLFKLTPEYGLADILSGHASPAKAVCETHIENLHLISNGGYPKNPSELLMDSRFTELLTHAQKRYDYVIID
TDMRKGYLDQLFKLTPEYGLADILSGHASPAKAVCETHIENLHLISNGGYPKNPSELLMDSRFTELLTHAQKRYDYVIID
TDMR                                                                        VIID
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPPVLAVTDSTIVGQHAGTVLLVSRYGNTTTRELEISADRLRQNKINIKGVILNGMKREANSMYDYYAYHSPQDGKKPVK
TPPVLAVTDSTIVGQHAGTVLLVSRYGNTTTRELEISADRLRQNKINIKGVILNGMKREANSMYDYYAYHSPQDGKKP  
TPP                                                            YDYYAY           
        
....:...
KETPENKA


© 1998-2020Legal notice