BYKdb

Annotate results for A0A1E9T6I0

A0A1E9T6I0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E9T6I0
DOMAINtad1/135MTILEFFRTTRANLWLLIIGIIIGAAVGFGYASLQPKVYAASSSGYVTVGESGTVDVLSG
STAAKERARSYAAIVSSEAVAQKIKQNTPELSLTTGQIRSSLTATAGDNAALITVSAQAS
SPKNAQLLANSALQA
DOMAINcd284/476TSAVPGEGKSTVSLSLARSLADAGSPVILIDADLRRPTVAKKLKLDAKVGLTQVLAGQVE
IANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLIKELSEEFIVVVDVPPLLPVTDA
SLLSHSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPRKGLGNSYYGFGY
ASTYVGYATYYGY
SITEWalker A291/293GKS
SITEWalker A'311/318ILIDADLR
SITEWalker B390/396VVVDVPP
SITEY Cluster458/476YYGFGYASTYVGYATYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTILEFFRTTRANLWLLIIGIIIGAAVGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
MTILEFFRTTRANLWLLIIGIIIGAAVGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQKIKQNTPELSLTTGQIRSSLTATAGDNAALITVSAQASSPKNAQLLANSALQATADYIKEIEQNPGNAQALVNGDSNA
AQKIKQNTPELSLTTGQIRSSLTATAGDNAALITVSAQASSPKNAQLLANSALQA                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AATPPANSNTVRVIPLNNASVNPPLVSPNYQQNTLIGAVIGLVVVYTAIFLRRALDQRIRTRDDATKATGASILGVLPVS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EDLNEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARSLADAGSPVILIDADLRRP
                                           TSAVPGEGKSTVSLSLARSLADAGSPVILIDADLRRP
                                                  GKS                 ILIDADLR  
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TVAKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLIKELSEEFIVVVDVPPLLPV
TVAKKLKLDAKVGLTQVLAGQVEIANAVHQLGDSNLFVLPAGRIPPNPSELLGSDKMRQLIKELSEEFIVVVDVPPLLPV
                                                                     VVVDVPP    
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDASLLSHSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPRKGLGNSYYGFGYASTYVGYATYYGYGKDG
TDASLLSHSVDGVILVGSIGRSHREQMTEASSILKKVNANLFGLVLNRAPRKGLGNSYYGFGYASTYVGYATYYGY    
                                                         YYGFGYASTYVGYATYYGY    
       490    
....:....|....
DKKSSKSKSSAPKA


© 1998-2020Legal notice