BYKdb

Annotate results for A0A1E9DXX2

A0A1E9DXX2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E9DXX2
DOMAINtad1/135MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSG
STAAKERARSYAAIVSSEAVAQKIKQNNPELSMTTGQIRGSLTATAGENAALITVNAKAS
SPKNAQLLANSALQA
DOMAINcd282/474TSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTVAKKLKLDAKVGLTQVLAGQVE
IANAVHQLGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTDA
SLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGY
ASAYVGYATYYGY
SITEWalker A289/291GKS
SITEWalker A'309/316ILIDADLR
SITEWalker B388/394VVVDVPP
SITEY Cluster456/474YYGFGYASAYVGYATYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV
MTILEFFRTTRANLWLLIIGIVVGAAAGFGYASLQPKVYAASSSGYVTVGESGTVDVLSGSTAAKERARSYAAIVSSEAV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQKIKQNNPELSMTTGQIRGSLTATAGENAALITVNAKASSPKNAQLLANSALQATADYIKEIEQNPGNAQALVNGDNAV
AQKIKQNNPELSMTTGQIRGSLTATAGENAALITVNAKASSPKNAQLLANSALQA                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSPTGGNTVRVIPLNNASVNPPLVAPNYKQNVLIGAGTGLVLVYAAIFLRRALDQRIRTRDDATKATGASILGVLPISDD


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNEENIVNGDTDDHIAQESIRQLRTNLRFVNVDTPPRSFIVTSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
                                         TSAVPGEGKSTVSLSLARAMADAGSPVILIDADLRRPTV
                                                GKS                 ILIDADLR    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
AKKLKLDAKVGLTQVLAGQVEIANAVHQLGESNLFVLPAGRIPPNPSELLGSDKMRQLINELSEEFIVVVDVPPLLPVTD
                                                                   VVVDVPP      
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGYGKEGDK
ASLLSHSVDGVILVGSIGRSHREQMTEASNILKKVNANLLGMVLNRAPRKGLGNSYYGFGYASAYVGYATYYGY      
                                                       YYGFGYASAYVGYATYYGY      
       490
....:....|
KSSKKSSAKK


© 1998-2020Legal notice