BYKdb

Annotate results for A0A1E8GCN0

A0A1E8GCN0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E8GCN0
DOMAINcd54/233TSSGPSEGKSTTSANLAVVFANSGQKVLIVDADMRKPTVAKTFALPNIGGLSTLLTTPQH
VTDIAQYSGIENLYVLTSGPKPPNPSELLGSMRMNEILQEARDNYDFVIFDMPPVVAVTD
AQIMASKVDGTLLVVRENVSRKDALLKAKNLLQMVNANVLGVVYNGAKNVADQGYYYYGA
SITEWalker A61/63GKS
SITEWalker A'81/88LIVDADMR
SITEWalker B161/167VIFDMPP
SITEY Cluster228/231YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKKNTRKKDTTHAVSLITLADASSPVSEQYRTIRTNIQFASTINNEIKTMVITSSGPSEGKSTTSANLAVVFANSGQKV
                                                     TSSGPSEGKSTTSANLAVVFANSGQKV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIVDADMRKPTVAKTFALPNIGGLSTLLTTPQHVTDIAQYSGIENLYVLTSGPKPPNPSELLGSMRMNEILQEARDNYDF
LIVDADMRKPTVAKTFALPNIGGLSTLLTTPQHVTDIAQYSGIENLYVLTSGPKPPNPSELLGSMRMNEILQEARDNYDF
LIVDADMR                                                                        
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
VIFDMPPVVAVTDAQIMASKVDGTLLVVRENVSRKDALLKAKNLLQMVNANVLGVVYNGAKNVADQGYYYYGA
VIFDMPPVVAVTDAQIMASKVDGTLLVVRENVSRKDALLKAKNLLQMVNANVLGVVYNGAKNVADQGYYYYGA
VIFDMPP                                                            YYYY  
© 1998-2020Legal notice