BYKdb

Annotate results for A0A1E8E0F8

A0A1E8E0F8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E8E0F8
DOMAINtad10/267DTIDLKELFFSLLSQWKLIALCTLLSLVFALLYLKVTPNVYSTDAMIQVEDAKGAGAAAL
LGDLGSAMPGGLGGKSAADAEIEILNSRKVLGQTIQDLKLDIRITDEQSSLTYRLLNTVQ
SKVIYKNNVVTWQDKKNVFVIQSFDVPNFYLDKKLTLNFINGQEFSLSYKKDVVFKGKLN
AINQSLDQKGLWKIQIYAKNPISHDFSVTKLSMPSAVKWIKKDYGVAERGKNSGVIGLNY
NGEDKEHITQVLNHILNI
DOMAINcd543/730SGPAPELGKSFISTNLATILAQSDKRVLLIDADLRRGYMHKYFNYDVQPGLAEYLNGQHE
LGNIVRSTEVENLSIISRGKSPANPSELLSTQKFADMLTHLSSQFDHILIDTPPVLAVTD
GIIISQYAGVNLVVARYGKTQMKELEMTVNRFEQAGVKVNGFILNDIQREAGGYGYGYNY
AYAYKANK
SITEWalker A550/552GKS
SITEWalker A'570/577LLIDADLR
SITEWalker B650/656ILIDTPP
SITE-580/-587YMHKYFNY
SITE-621/-623GKS
SITEY Cluster716/726YGYGYNYAYAY
SITE-680/-682GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNSNSTPQDDTIDLKELFFSLLSQWKLIALCTLLSLVFALLYLKVTPNVYSTDAMIQVEDAKGAGAAALLGDLGSAMPGG
         DTIDLKELFFSLLSQWKLIALCTLLSLVFALLYLKVTPNVYSTDAMIQVEDAKGAGAAALLGDLGSAMPGG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGGKSAADAEIEILNSRKVLGQTIQDLKLDIRITDEQSSLTYRLLNTVQSKVIYKNNVVTWQDKKNVFVIQSFDVPNFYL
LGGKSAADAEIEILNSRKVLGQTIQDLKLDIRITDEQSSLTYRLLNTVQSKVIYKNNVVTWQDKKNVFVIQSFDVPNFYL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DKKLTLNFINGQEFSLSYKKDVVFKGKLNAINQSLDQKGLWKIQIYAKNPISHDFSVTKLSMPSAVKWIKKDYGVAERGK
DKKLTLNFINGQEFSLSYKKDVVFKGKLNAINQSLDQKGLWKIQIYAKNPISHDFSVTKLSMPSAVKWIKKDYGVAERGK

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NSGVIGLNYNGEDKEHITQVLNHILNIYQAQNIERKSLESAQTLSFLEKQLPELKQQLEDSEIKFNRFREQYNTIDVTQE
NSGVIGLNYNGEDKEHITQVLNHILNI                                                     

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AELMLKQNVELEKLKIQLQQQQAELSSKYTPDHPLMSAINAQLSEINKKTSEMTQSIKRLPETQRLYLQLHRDVKVNAEL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YTALLNSYQQLKIANAGEIGNVRIIDTAIEPVKPIKPKKLIILVLAIFVGGFLGTLLALLRNMLRSGIKDSNKIENELDL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVYATVPRSPVQESRINILKKKKNIPILAVKHSDDIAIESLRSMRTAIHFALSSAKNNIIMISGPAPELGKSFISTNLAT
                                                              SGPAPELGKSFISTNLAT
                                                                     GKS        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILAQSDKRVLLIDADLRRGYMHKYFNYDVQPGLAEYLNGQHELGNIVRSTEVENLSIISRGKSPANPSELLSTQKFADML
ILAQSDKRVLLIDADLRRGYMHKYFNYDVQPGLAEYLNGQHELGNIVRSTEVENLSIISRGKSPANPSELLSTQKFADML
         LLIDADLR                                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
THLSSQFDHILIDTPPVLAVTDGIIISQYAGVNLVVARYGKTQMKELEMTVNRFEQAGVKVNGFILNDIQREAGGYGYGY
THLSSQFDHILIDTPPVLAVTDGIIISQYAGVNLVVARYGKTQMKELEMTVNRFEQAGVKVNGFILNDIQREAGGYGYGY
         ILIDTPP                                                           YGYGY
       730   
....:....|...
NYAYAYKANKDED
NYAYAYKANK   
NYAYAY       

© 1998-2020Legal notice