BYKdb

Annotate results for A0A1E7Z8Z4

A0A1E7Z8Z4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E7Z8Z4
DOMAINtad17/202VAIDFGHYWAVIKRNLFYVVVFALVMSGVAVWAAKQLTPMYLSTVSILVESKAASPVSVE
EIYGFDASKKEYMKTQFEILRSRKIAEKTVRRMELHNNPIFMPESSTPSLMSQVRGWVSE
VTGGAETPSARLSEEEINNAKVKATAAKLLSSVAIVLVKDTQIMELSVSSPSAELSSQIA
NTMADV
DOMAINcd542/731TSTLPQEGKSTVATNLAFALGQIEETLIIDADLRRPSIAKLFGLPKYQPGLSNLIMATHS
LDECVVKDEESGLHVISAGTVPDHAQELLDSEAFANCIKALKSKYKYVVLDSAPSQSVAD
SLVASKVCDSVIYVVKAHDTSENLVSNGISRFLRIGSRVDGVVLNQVNVKKYSKYDSYAG
YYDEYEYGKS
SITEWalker A549/551GKS
SITEWalker A'568/575LIIDADLR
SITEWalker B649/655VVLDSAP
SITE-646/-648YKY
SITE-729/-731GKS
SITEY Cluster713/728YSKYDSYAGYYDEYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGNNVKEQLQARFFDEVAIDFGHYWAVIKRNLFYVVVFALVMSGVAVWAAKQLTPMYLSTVSILVESKAASPVSVEEIYG
                VAIDFGHYWAVIKRNLFYVVVFALVMSGVAVWAAKQLTPMYLSTVSILVESKAASPVSVEEIYG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDASKKEYMKTQFEILRSRKIAEKTVRRMELHNNPIFMPESSTPSLMSQVRGWVSEVTGGAETPSARLSEEEINNAKVKA
FDASKKEYMKTQFEILRSRKIAEKTVRRMELHNNPIFMPESSTPSLMSQVRGWVSEVTGGAETPSARLSEEEINNAKVKA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAAKLLSSVAIVLVKDTQIMELSVSSPSAELSSQIANTMADVYVENYFQEKVEMTTKATNFLTESISGLRTKLDKAEQKL
TAAKLLSSVAIVLVKDTQIMELSVSSPSAELSSQIANTMADV                                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSFYEENQVVNIDGVTGLAGDRLSQLNSQLMTAQHELEANRAIYERTRQQVDRETMYSLPAILNHPAIQRTRDEELKAVR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVSELEKTYGPKHPVMVAAQAELIAIRGALESQVDELLSSIGTQYQSALERVSKLQTEVQVAEENYRRLTGLETTRSALQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REVSVNQQLYDSFFSRLQETSEIMDFESSNARILDVAEVPAFPSKPNKPLIVIATFIASFGLGVVVALGLDMSNSTVRTP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EDVERKLGQRMLGILPLIKGNKLALRTYFDGSNHQFSESIRTLRSSLSLLNIERQNKCIIVTSTLPQEGKSTVATNLAFA
                                                             TSTLPQEGKSTVATNLAFA
                                                                    GKS         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGQIEETLIIDADLRRPSIAKLFGLPKYQPGLSNLIMATHSLDECVVKDEESGLHVISAGTVPDHAQELLDSEAFANCIK
LGQIEETLIIDADLRRPSIAKLFGLPKYQPGLSNLIMATHSLDECVVKDEESGLHVISAGTVPDHAQELLDSEAFANCIK
       LIIDADLR                                                                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALKSKYKYVVLDSAPSQSVADSLVASKVCDSVIYVVKAHDTSENLVSNGISRFLRIGSRVDGVVLNQVNVKKYSKYDSYA
ALKSKYKYVVLDSAPSQSVADSLVASKVCDSVIYVVKAHDTSENLVSNGISRFLRIGSRVDGVVLNQVNVKKYSKYDSYA
        VVLDSAP                                                         YSKYDSYA
       730 
....:....|.
GYYDEYEYGKS
GYYDEYEYGKS
GYYDEYEY   

© 1998-2020Legal notice