BYKdb

Annotate results for A0A1E7S2H3

A0A1E7S2H3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E7S2H3
DOMAINcd41/228TSTGKGEGKSTIIANYAVALAQSKKKVLLIDCDLRRPRIHRLFEQPNKRGLTNILLRECE
PTEAIQTTDVENLFMISSGPIPPNPSEILASKRLIELINQFKLAFDYILIDAPPVGVVTD
AAVLSHVTDGYIVVAAISVTNKEGVRMALETLRNVNGNIVGVVANNAPVSKRSGYYYYYS
AYEEDQHQ
SITEWalker A48/50GKS
SITEWalker A'68/75LLIDCDLR
SITEWalker B148/154ILIDAPP
SITEY Cluster215/222YYYYYSAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKDSIITYKSPKDPISEAFRNMRTNITFADIDEELRVLTITSTGKGEGKSTIIANYAVALAQSKKKVLLIDCDLRRPRIH
                                        TSTGKGEGKSTIIANYAVALAQSKKKVLLIDCDLRRPRIH
                                               GKS                 LLIDCDLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLFEQPNKRGLTNILLRECEPTEAIQTTDVENLFMISSGPIPPNPSEILASKRLIELINQFKLAFDYILIDAPPVGVVTD
RLFEQPNKRGLTNILLRECEPTEAIQTTDVENLFMISSGPIPPNPSEILASKRLIELINQFKLAFDYILIDAPPVGVVTD
                                                                   ILIDAPP      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAVLSHVTDGYIVVAAISVTNKEGVRMALETLRNVNGNIVGVVANNAPVSKRSGYYYYYSAYEEDQHQSKKEKKHRKIKE
AAVLSHVTDGYIVVAAISVTNKEGVRMALETLRNVNGNIVGVVANNAPVSKRSGYYYYYSAYEEDQHQ            
                                                      YYYYYSAY                  
    
....
KRGK


© 1998-2020Legal notice