BYKdb

Annotate results for A0A1E7JEV6

A0A1E7JEV6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E7JEV6
DOMAINcd92/270TSALPGEGKTLTSVNLALTFAKELTHPVLLVDCDLRRQNIHQYLGFSSDKGVIDNLADDF
PLDDLIIWPGIEKLHVISGGRTVHDSTEMLSSHKMKAAIVEMKKRYKDRYVFFDAPPILS
AADAIAFSPLVDCILIVVQAASTSIRDVKKAVEMIPKDKFLGFVLNRQRSPIKGYYKYH
SITEWalker A99/101GKT
SITEWalker A'120/127LLVDCDLR
SITEWalker B202/208VFFDAPP
SITE-197/-201YKDRY
SITEY Cluster266/269YYKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MYLRKSVEKVKKMPNIAKQSNLSENLPEREEAGWTKVANREIKCVDLEEKKAVENHCVCILPDAEELDFYKILRAQIQHR


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CKKNGWNTIMITSALPGEGKTLTSVNLALTFAKELTHPVLLVDCDLRRQNIHQYLGFSSDKGVIDNLADDFPLDDLIIWP
           TSALPGEGKTLTSVNLALTFAKELTHPVLLVDCDLRRQNIHQYLGFSSDKGVIDNLADDFPLDDLIIWP
                  GKT                  LLVDCDLR                                 
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GIEKLHVISGGRTVHDSTEMLSSHKMKAAIVEMKKRYKDRYVFFDAPPILSAADAIAFSPLVDCILIVVQAASTSIRDVK
GIEKLHVISGGRTVHDSTEMLSSHKMKAAIVEMKKRYKDRYVFFDAPPILSAADAIAFSPLVDCILIVVQAASTSIRDVK
                                         VFFDAPP                                
       250       260       270
....:....|....:....|....:....|
KAVEMIPKDKFLGFVLNRQRSPIKGYYKYH
KAVEMIPKDKFLGFVLNRQRSPIKGYYKYH
                         YYKY 
© 1998-2020Legal notice