BYKdb

Annotate results for A0A1E7JCL5

A0A1E7JCL5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E7JCL5
DOMAINcd85/271TSAQPMEGKTIVAANLAISIAHGINEHVLLVDCDLRRPSMNTLLGLNAGKGIHEYMEDGT
SVAPYLMKTPIKKLSLLPAGKPPSNPSELLSSEKMRRLVEELRGRYEDRYIIFDSAPAQC
ASEAAFLASMVDTVLLVVRSGKSAKDLILKAIEKIGRKKILGVVFNASNESAKDYNYYYR
YYRKEQK
SITE-225/-227GKS
SITEWalker A'113/120LLVDCDLR
SITEWalker B195/201IIFDSAP
SITE-190/-194YEDRY
SITEY Cluster259/266YNYYYRYY
SITEWalker A92/94GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGKFFEALRKSETTKRQTSARLLPKNVVNISPQTIEKSPLPQSAMDPRLVSFMDPDSPAVECFKMLRATIFTINPGFRPR


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TIMVTSAQPMEGKTIVAANLAISIAHGINEHVLLVDCDLRRPSMNTLLGLNAGKGIHEYMEDGTSVAPYLMKTPIKKLSL
    TSAQPMEGKTIVAANLAISIAHGINEHVLLVDCDLRRPSMNTLLGLNAGKGIHEYMEDGTSVAPYLMKTPIKKLSL
           GKT                  LLVDCDLR                                        
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPAGKPPSNPSELLSSEKMRRLVEELRGRYEDRYIIFDSAPAQCASEAAFLASMVDTVLLVVRSGKSAKDLILKAIEKIG
LPAGKPPSNPSELLSSEKMRRLVEELRGRYEDRYIIFDSAPAQCASEAAFLASMVDTVLLVVRSGKSAKDLILKAIEKIG
                                  IIFDSAP                                       
       250       260       270 
....:....|....:....|....:....|.
RKKILGVVFNASNESAKDYNYYYRYYRKEQK
RKKILGVVFNASNESAKDYNYYYRYYRKEQK
                  YNYYYRYY     
© 1998-2020Legal notice