BYKdb

Annotate results for A0A1E7IQC3

A0A1E7IQC3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E7IQC3
DOMAINcd99/278TSTVSEEGKSMTALNLAISLAKEHDHTVLLVDTDLRRPSVHKFLDIKPEVGLVHCLRDNL
PIEKALIKTGIGKLVVLPAGEAVNDPVDMLSSNRMKEIIRELRERYADRYVIFDTPPALP
FADAGVLAANMDATLFVVREGKARREDIVKTLDNFKGHNLLGVIYNDAHAFMKKQDYYYY
SITEWalker A106/108GKS
SITEWalker A'127/134LLVDTDLR
SITEWalker B209/215VIFDTPP
SITE-204/-208YADRY
SITEY Cluster275/278YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRIQDALNKAASRRKSPVESAAEINHAAAQKNELVSESQLPEKQFSNLLDVPPIKVDNLMLATARDEKTEVVEEYNKLR


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAVIALTKGDKFSNTLMVTSTVSEEGKSMTALNLAISLAKEHDHTVLLVDTDLRRPSVHKFLDIKPEVGLVHCLRDNLPI
                  TSTVSEEGKSMTALNLAISLAKEHDHTVLLVDTDLRRPSVHKFLDIKPEVGLVHCLRDNLPI
                         GKS                  LLVDTDLR                          
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKALIKTGIGKLVVLPAGEAVNDPVDMLSSNRMKEIIRELRERYADRYVIFDTPPALPFADAGVLAANMDATLFVVREGK
EKALIKTGIGKLVVLPAGEAVNDPVDMLSSNRMKEIIRELRERYADRYVIFDTPPALPFADAGVLAANMDATLFVVREGK
                                                VIFDTPP                         
       250       260       270        
....:....|....:....|....:....|....:...
ARREDIVKTLDNFKGHNLLGVIYNDAHAFMKKQDYYYY
ARREDIVKTLDNFKGHNLLGVIYNDAHAFMKKQDYYYY
                                  YYYY
© 1998-2020Legal notice