BYKdb

Annotate results for A0A1E7HSL6

A0A1E7HSL6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E7HSL6
DOMAINcd88/270TSVASGEGKTFVAANLAISIAQNLEENVLLIDCDLRAPSVHARFGMHGVNGISEHFLKGI
DILPLIQKTPVKNLTVLPAGGTSLESAKLLSSQRMSKALDLLKAGQENQFIFIDAPPPLL
TAETAALAKYVDGIILVIQYGSTPRDMVAELIKYIGKEKIAGIVLNRYKMKRAGYYKYGY
GSA
SITEWalker A95/97GKT
SITEWalker A'116/123LLIDCDLR
SITEWalker B198/204IFIDAPP
SITEY Cluster262/267YYKYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGKISSAIEKSNRENWSTSINKKSETDPPPPNITTFKEFGLLRKNRNIDKGLIALLKPDSFEAEQFRKLGTTLLYAGSET


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPRCFLVTSVASGEGKTFVAANLAISIAQNLEENVLLIDCDLRAPSVHARFGMHGVNGISEHFLKGIDILPLIQKTPVKN
       TSVASGEGKTFVAANLAISIAQNLEENVLLIDCDLRAPSVHARFGMHGVNGISEHFLKGIDILPLIQKTPVKN
              GKT                  LLIDCDLR                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTVLPAGGTSLESAKLLSSQRMSKALDLLKAGQENQFIFIDAPPPLLTAETAALAKYVDGIILVIQYGSTPRDMVAELIK
LTVLPAGGTSLESAKLLSSQRMSKALDLLKAGQENQFIFIDAPPPLLTAETAALAKYVDGIILVIQYGSTPRDMVAELIK
                                     IFIDAPP                                    
       250       260       270
....:....|....:....|....:....|
YIGKEKIAGIVLNRYKMKRAGYYKYGYGSA
YIGKEKIAGIVLNRYKMKRAGYYKYGYGSA
                     YYKYGY   
© 1998-2020Legal notice