BYKdb

Annotate results for A0A1E7HFN0

A0A1E7HFN0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E7HFN0
DOMAINcd94/271TSAVAGEGKTVTAVNLAVSIARDVQHTVLLVDTDLRNPQIHHYLGCNATRGLSDYILDDV
PLAELLVNPGIGKMVVLPAGKSLPGSTEILGSPAIKNLVLEMKNRYPDRYVIFDSPPLLG
LPDSLVFSSYIDGIILVVEAGSTPKDQIRKAIQLLEGKTILGLVMNKSPEAEQDYYYY
SITEWalker A101/103GKT
SITEWalker A'122/129LLVDTDLR
SITEWalker B204/210VIFDSPP
SITE-199/-203YPDRY
SITE-173/-175GKS
SITEY Cluster268/271YYYY
SITE-250/-252GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSMIKKALQRARKDRHEEGHRIPVEQAASEMPGLAEKVRGDTRTKAISLDHSHIEKHRIVMPSGDPKILDCYNLLRTQVL


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRTRDKGYRTIMVTSAVAGEGKTVTAVNLAVSIARDVQHTVLLVDTDLRNPQIHHYLGCNATRGLSDYILDDVPLAELLV
             TSAVAGEGKTVTAVNLAVSIARDVQHTVLLVDTDLRNPQIHHYLGCNATRGLSDYILDDVPLAELLV
                    GKT                  LLVDTDLR                               
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPGIGKMVVLPAGKSLPGSTEILGSPAIKNLVLEMKNRYPDRYVIFDSPPLLGLPDSLVFSSYIDGIILVVEAGSTPKDQ
NPGIGKMVVLPAGKSLPGSTEILGSPAIKNLVLEMKNRYPDRYVIFDSPPLLGLPDSLVFSSYIDGIILVVEAGSTPKDQ
                                           VIFDSPP                              
       250       260       270 
....:....|....:....|....:....|.
IRKAIQLLEGKTILGLVMNKSPEAEQDYYYY
IRKAIQLLEGKTILGLVMNKSPEAEQDYYYY
                           YYYY
© 1998-2020Legal notice