BYKdb

Annotate results for A0A1E7HCR6

A0A1E7HCR6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E7HCR6
DOMAINtad10/205YDVDLRSYLKIIRDRWVITVSVMAVILLITIIATYTTTPIYTAQSQVLVERNRGKSALES
NYYYYEPDFLETQSVIIKSENVALKVVKNLQLATKYKRYFFKDNSEGFSLVGFIREKISS
LVKSISSLGSGSQKEGSPDTPDSIDFEPKSDEEVIADIIRGGLNVVPVRNTKVVTISYTD
KDPAIARIVADEVVKA
DOMAINcd547/733TSMSSAEGKTATVINLARMLAQDRKSVLIIDCDLRRPRMHSMLGIPNDKGLSVYLAGNID
ECTVLKIPDEEISLVPAGPIPPDPAELLGSSRMQALLDEVTPKFDFVLFDSPPVGAVTDS
LTLSRYADGTILVVKAGSTTIEMLEGGIKKMNDINARILGVVLNRVKKIEQDSYQYGYGA
YYDRDND
SITEWalker A554/556GKT
SITEWalker A'574/581LIIDCDLR
SITEWalker B653/659VLFDSPP
SITEY Cluster720/728YQYGYGAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNNPDEFEEYDVDLRSYLKIIRDRWVITVSVMAVILLITIIATYTTTPIYTAQSQVLVERNRGKSALESNYYYYEPDFLE
         YDVDLRSYLKIIRDRWVITVSVMAVILLITIIATYTTTPIYTAQSQVLVERNRGKSALESNYYYYEPDFLE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQSVIIKSENVALKVVKNLQLATKYKRYFFKDNSEGFSLVGFIREKISSLVKSISSLGSGSQKEGSPDTPDSIDFEPKSD
TQSVIIKSENVALKVVKNLQLATKYKRYFFKDNSEGFSLVGFIREKISSLVKSISSLGSGSQKEGSPDTPDSIDFEPKSD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEVIADIIRGGLNVVPVRNTKVVTISYTDKDPAIARIVADEVVKAYMDEMLDIKLSTSSYSLKWMTEKAGEERDKLERSE
EEVIADIIRGGLNVVPVRNTKVVTISYTDKDPAIARIVADEVVKA                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RELQHFMRENDLVTVENRLTVLPQKLSEFGSQQSKAEAEKKELQDLLDQVRMAENDTERLEKIPLFASDTVLKNIRERLY


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KANQNIQELSKKYGRKHPVMIRAKDEQRILKEERRFEIDRIVSSIENSYGLAASKEENLHELLGTTKGEMLDLNEKFMQY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SMMKRSVDSNRVLYDTLQTSIKEQGVTEQTQTVNIWVIKKAALPLAPSKPNKKRNLLLGLILGLFSGIGLAFFIEYLDNT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNSGRQVEEKFGLTVLGSIEELKGKENNIDTYVRNNLLSPLAESYRLIRSALLLSTANHPPKVVLITSMSSAEGKTATVI
                                                                  TSMSSAEGKTATVI
                                                                         GKT    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLARMLAQDRKSVLIIDCDLRRPRMHSMLGIPNDKGLSVYLAGNIDECTVLKIPDEEISLVPAGPIPPDPAELLGSSRMQ
NLARMLAQDRKSVLIIDCDLRRPRMHSMLGIPNDKGLSVYLAGNIDECTVLKIPDEEISLVPAGPIPPDPAELLGSSRMQ
             LIIDCDLR                                                           
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALLDEVTPKFDFVLFDSPPVGAVTDSLTLSRYADGTILVVKAGSTTIEMLEGGIKKMNDINARILGVVLNRVKKIEQDSY
ALLDEVTPKFDFVLFDSPPVGAVTDSLTLSRYADGTILVVKAGSTTIEMLEGGIKKMNDINARILGVVLNRVKKIEQDSY
            VLFDSPP                                                            Y
       730   
....:....|...
QYGYGAYYDRDND
QYGYGAYYDRDND
QYGYGAYY     

© 1998-2020Legal notice