BYKdb

Annotate results for A0A1E7H876

A0A1E7H876 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E7H876
DOMAINcd67/261TSSAPQEGKSFVSANLAVTIARGLDQHALLVDCDLRRPSLARLFGLASICRRGLSDYLRE
DCDISELIHKTSIEKLSLLSSGDSPVNPAELLSSSRMSRLVTELSSRYKDRFIIFDTPPY
QVASETNVLAKEVEGVVLVVGYGKSDKSHIKTMVDLIGPEKILGVVFNGMKNSYIQKKVF
SSYGYSGGYYGEDET
SITE-209/-211GKS
SITEWalker A'95/102LLVDCDLR
SITEWalker B179/185IIFDTPP
SITEY Cluster249/256YGYSGGYY
SITEWalker A74/76GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSGQPAAEPVRKKTIKHQTLSSSEAWDERLLKVTHSSSEAAESFRILRSRILYPQDGRQRPQSILVTSSAPQEGKSFVSA
                                                                  TSSAPQEGKSFVSA
                                                                         GKS    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLAVTIARGLDQHALLVDCDLRRPSLARLFGLASICRRGLSDYLREDCDISELIHKTSIEKLSLLSSGDSPVNPAELLSS
NLAVTIARGLDQHALLVDCDLRRPSLARLFGLASICRRGLSDYLREDCDISELIHKTSIEKLSLLSSGDSPVNPAELLSS
              LLVDCDLR                                                          
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRMSRLVTELSSRYKDRFIIFDTPPYQVASETNVLAKEVEGVVLVVGYGKSDKSHIKTMVDLIGPEKILGVVFNGMKNSY
SRMSRLVTELSSRYKDRFIIFDTPPYQVASETNVLAKEVEGVVLVVGYGKSDKSHIKTMVDLIGPEKILGVVFNGMKNSY
                  IIFDTPP                                                       
       250       260  
....:....|....:....|..
IQKKVFSSYGYSGGYYGEDETD
IQKKVFSSYGYSGGYYGEDET 
        YGYSGGYY      
© 1998-2020Legal notice