BYKdb

Annotate results for A0A1E5QP61

A0A1E5QP61 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E5QP61
DOMAINtad8/158EGIDFQKYWLVLKRHWLPASSVFALIVTLATYKAATADPVYEAQGKLLFKKQNTTSALVT
DAGAKIGQLDTLTQFNNPLDTEAEVISSMPIVKETVEALNFRDDQGKFIPPGDFLSQLNV
KKIEGTDVLMIAFKSQYPKEAADAVNKLMDV
DOMAINcd534/721TSAVSQEGKSTVAANLAVATAQLGRRVLLIDGDMRHSTQHQIWNLTNVAGLSDVIANQAK
FNIAVREVMENLDVLPSGATPPNPLALIDSKRMASLLEEFRDNYEFIIIDTPPFLLVADA
LALGKMTDGLLLVTRPGIIDTASAGGAREILAQSGQNVLGLVVNGVSAGSEPDGAFQRVK
AYHKGKYK
SITEWalker A541/543GKS
SITEWalker A'561/568LLIDGDMR
SITEWalker B640/646IIIDTPP
SITEY Cluster715/720YHKGKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDSTDYTEGIDFQKYWLVLKRHWLPASSVFALIVTLATYKAATADPVYEAQGKLLFKKQNTTSALVTDAGAKIGQLDTLT
       EGIDFQKYWLVLKRHWLPASSVFALIVTLATYKAATADPVYEAQGKLLFKKQNTTSALVTDAGAKIGQLDTLT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QFNNPLDTEAEVISSMPIVKETVEALNFRDDQGKFIPPGDFLSQLNVKKIEGTDVLMIAFKSQYPKEAADAVNKLMDVYI
QFNNPLDTEAEVISSMPIVKETVEALNFRDDQGKFIPPGDFLSQLNVKKIEGTDVLMIAFKSQYPKEAADAVNKLMDV  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNNILVNRREATAAREFIMQQLPDTEETVRQAEAALRAFKEENSVVSLQDEATSAVISISNLDSEVIKAQAQYEDATARS


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QALQSQMGLNPQQALAINTLSQSAAIQQVLTEYQKVQDQLAVQRTRYQSQHPIITNLERREAALSDLLQERVAQVLGNNQ


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVDRRDLQIGELQQQLTADLVNAEVQRLGLGSNVSALVRAQGSYRDRANALPRLEQQQRDLQRQLDAAQSAYQILLRNLQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVRIAENQNVGNARVISYATLPVNPVAPNKKLLVAAGVVGGSMLYVLTAFLLELMDPSIKTAKELRMLFRYTLLGMIPAT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKRFGFLGFSSRREIPLLPTRDQPTTYTSEAYRTLQANLKFISPDREIRIIVVTSAVSQEGKSTVAANLAVATAQLGRRV
                                                     TSAVSQEGKSTVAANLAVATAQLGRRV
                                                            GKS                 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIDGDMRHSTQHQIWNLTNVAGLSDVIANQAKFNIAVREVMENLDVLPSGATPPNPLALIDSKRMASLLEEFRDNYEFI
LLIDGDMRHSTQHQIWNLTNVAGLSDVIANQAKFNIAVREVMENLDVLPSGATPPNPLALIDSKRMASLLEEFRDNYEFI
LLIDGDMR                                                                       I
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIDTPPFLLVADALALGKMTDGLLLVTRPGIIDTASAGGAREILAQSGQNVLGLVVNGVSAGSEPDGAFQRVKAYHKGKY
IIDTPPFLLVADALALGKMTDGLLLVTRPGIIDTASAGGAREILAQSGQNVLGLVVNGVSAGSEPDGAFQRVKAYHKGKY
IIDTPP                                                                    YHKGKY
       730       740     
....:....|....:....|....:
KDAAIKKVTVPSESSSDPSFPDWDR
K                        

© 1998-2020Legal notice