BYKdb

Annotate results for A0A1E5MK42

A0A1E5MK42 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E5MK42
DOMAINtad1/135MTLVQFAAVLRRRWSSLVVLTLVGIGVGATLTLVMTPMFRAQAQVFVSVDAGPTASDLSQ
GGSFSESRVASYAELAASPSVLRAAAAAAHVEGTIEQLSRQVRVASSLETVILTITATDP
DPQRAAAFADAIAEK
DOMAINcd267/458TSAVAGEGKSSTALNLAFMLAQNGHRTLLIDGDLRRPTVADALDLEGSVGLSTVLAHQVE
LEEAVQVVGRDGLHVLASGQVPPNPSELLSSRQMRFIVDSAAAAFDYVIIDAPPALPVTD
PAVLGALATGVLVVSATDGHTTVRELEQSLETIDAVGARVVGLVANRVRAGRKPASYYDY
SSAEPIKESRRR
SITEWalker A274/276GKS
SITEWalker A'294/301LLIDGDLR
SITEWalker B374/380VIIDAPP
SITEY Cluster443/446YYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLVQFAAVLRRRWSSLVVLTLVGIGVGATLTLVMTPMFRAQAQVFVSVDAGPTASDLSQGGSFSESRVASYAELAASPS
MTLVQFAAVLRRRWSSLVVLTLVGIGVGATLTLVMTPMFRAQAQVFVSVDAGPTASDLSQGGSFSESRVASYAELAASPS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLRAAAAAAHVEGTIEQLSRQVRVASSLETVILTITATDPDPQRAAAFADAIAEKTVELVGEIEKTDSAGESLVKLSVYQ
VLRAAAAAAHVEGTIEQLSRQVRVASSLETVILTITATDPDPQRAAAFADAIAEK                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HAETPSAPSSPRVTTNVVVGAFLGLILAIIAAMVREALDSRIRTVDDLRRATERSVLAEIPVADDVVALRRPEVGTKFSE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAESYRQLRTHLTFTNLDGACQVIVVTSAVAGEGKSSTALNLAFMLAQNGHRTLLIDGDLRRPTVADALDLEGSVGLSTV
                          TSAVAGEGKSSTALNLAFMLAQNGHRTLLIDGDLRRPTVADALDLEGSVGLSTV
                                 GKS                 LLIDGDLR                   
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAHQVELEEAVQVVGRDGLHVLASGQVPPNPSELLSSRQMRFIVDSAAAAFDYVIIDAPPALPVTDPAVLGALATGVLVV
LAHQVELEEAVQVVGRDGLHVLASGQVPPNPSELLSSRQMRFIVDSAAAAFDYVIIDAPPALPVTDPAVLGALATGVLVV
                                                     VIIDAPP                    
       410       420       430       440       450       460     
....:....|....:....|....:....|....:....|....:....|....:....|....:
SATDGHTTVRELEQSLETIDAVGARVVGLVANRVRAGRKPASYYDYSSAEPIKESRRRTRRASFG
SATDGHTTVRELEQSLETIDAVGARVVGLVANRVRAGRKPASYYDYSSAEPIKESRRR       
                                          YYDY                   
© 1998-2020Legal notice