BYKdb

Annotate results for A0A1E5LDH3

A0A1E5LDH3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E5LDH3
DOMAINcd50/230TSSNPGEGKSTTIANLAVTFAQQGKKVLLIDTDMRKSTVHYTFRLENTTGLTNVLTKQVK
LLEAIKSINESNMDVLTSGPVPPNPAELLGSQSMKDLLDEAREHYDIILFDSPPLLAVTD
AQILSNQCDGVILVVHSGKTAKEDAQKAKELLQTAQAKILGAVINQKKLKASNYYYYYGN
N
SITE-187/-189GKT
SITEWalker A'77/84LLIDTDMR
SITEWalker B157/163ILFDSPP
SITEY Cluster223/227YYYYY
SITEWalker A57/59GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARKKNNLSSGRNLITQTDPKSPISEQYRTIRTNIQFASIDKQIKTIVVTSSNPGEGKSTTIANLAVTFAQQGKKVLLID
                                                 TSSNPGEGKSTTIANLAVTFAQQGKKVLLID
                                                        GKS                 LLID
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDMRKSTVHYTFRLENTTGLTNVLTKQVKLLEAIKSINESNMDVLTSGPVPPNPAELLGSQSMKDLLDEAREHYDIILFD
TDMRKSTVHYTFRLENTTGLTNVLTKQVKLLEAIKSINESNMDVLTSGPVPPNPAELLGSQSMKDLLDEAREHYDIILFD
TDMR                                                                        ILFD
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPPLLAVTDAQILSNQCDGVILVVHSGKTAKEDAQKAKELLQTAQAKILGAVINQKKLKASNYYYYYGNN
SPPLLAVTDAQILSNQCDGVILVVHSGKTAKEDAQKAKELLQTAQAKILGAVINQKKLKASNYYYYYGNN
SPP                                                           YYYYY   
© 1998-2020Legal notice