BYKdb

Annotate results for A0A1E5KXN4

A0A1E5KXN4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E5KXN4
DOMAINcd53/232TSSGPGEGKSTSSANIAIVFANAGQKVLLVDADMRKPTIAKTFAVSNTRGLSSLLSNRNT
SLEQVVQPVGIDNLSVITSGPKPPNPSELLGSVKMNQLIKDLKREYDLVIFDMPPVVTVT
DAQIVASKADGTMLVVRENVSKKDSMLKAKTLLQMVNANVIGVIYNGAKNASDQGYYYGN
SITEWalker A60/62GKS
SITEWalker A'80/87LLVDADMR
SITEWalker B161/167VIFDMPP
SITEY Cluster228/230YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKLRQPKRQETKAVSLITMADKSSPVSEQYRTIRTNIQYAMVDRELKTLVVTSSGPGEGKSTSSANIAIVFANAGQKVL
                                                    TSSGPGEGKSTSSANIAIVFANAGQKVL
                                                           GKS                 L
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDADMRKPTIAKTFAVSNTRGLSSLLSNRNTSLEQVVQPVGIDNLSVITSGPKPPNPSELLGSVKMNQLIKDLKREYDL
LVDADMRKPTIAKTFAVSNTRGLSSLLSNRNTSLEQVVQPVGIDNLSVITSGPKPPNPSELLGSVKMNQLIKDLKREYDL
LVDADMR                                                                         
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
VIFDMPPVVTVTDAQIVASKADGTMLVVRENVSKKDSMLKAKTLLQMVNANVIGVIYNGAKNASDQGYYYGN
VIFDMPPVVTVTDAQIVASKADGTMLVVRENVSKKDSMLKAKTLLQMVNANVIGVIYNGAKNASDQGYYYGN
VIFDMPP                                                            YYY  
© 1998-2020Legal notice