BYKdb

Annotate results for A0A1E5KSF5

A0A1E5KSF5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E5KSF5
DOMAINcd60/242TSCEQNSGKTLISANLAISFARGGKKTLIIDGDLRNPSLQRYFYCDRNRGLSSIGDISQL
KDNIFETEQENLYILPAGSININPADYFKSSKMKEIFNELRMHFDIIIVDTPPLLAVSDA
SVVSNYADGIIVVFRSGKTKLKNAKKTLRILEQSPTPVIGSILNDTNEFRDDYYYNYNYT
KSF
SITE-196/-198GKT
SITEWalker A'87/94LIIDGDLR
SITEWalker B166/172IIVDTPP
SITE-101/-103YFY
SITEY Cluster232/238YYYNYNY
SITEWalker A67/69GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEEQYVTFRSHEFKRNNREEGDKLVLVTRPLSVATEQFLSIRTSLDFIVEEDAVKVMVVTSCEQNSGKTLISANLAISFA
                                                           TSCEQNSGKTLISANLAISFA
                                                                  GKT           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RGGKKTLIIDGDLRNPSLQRYFYCDRNRGLSSIGDISQLKDNIFETEQENLYILPAGSININPADYFKSSKMKEIFNELR
RGGKKTLIIDGDLRNPSLQRYFYCDRNRGLSSIGDISQLKDNIFETEQENLYILPAGSININPADYFKSSKMKEIFNELR
      LIIDGDLR                                                                  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHFDIIIVDTPPLLAVSDASVVSNYADGIIVVFRSGKTKLKNAKKTLRILEQSPTPVIGSILNDTNEFRDDYYYNYNYTK
MHFDIIIVDTPPLLAVSDASVVSNYADGIIVVFRSGKTKLKNAKKTLRILEQSPTPVIGSILNDTNEFRDDYYYNYNYTK
     IIVDTPP                                                           YYYNYNY  
  
..
SF
SF

© 1998-2020Legal notice