BYKdb

Annotate results for A0A1E5HFH0

A0A1E5HFH0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E5HFH0
DOMAINcd55/234TSSGPSEGKSTTSANLAIVFANSGKRVLLVDADMRKPTVAKTFTLDNARGLSTLLGSRET
MLHQVVQPSGVDNLFLMASGPKPPNPSELLDSRRMQELLQELKHQYDLVIFDMPPVVAVT
DAQIVSSKSDGTILVVRENVSKRDSLLKAKSLLELVDANILGVVYNGSKSIEDQGYYYGS
SITEWalker A62/64GKS
SITEWalker A'82/89LLVDADMR
SITEWalker B163/169VIFDMPP
SITEY Cluster230/232YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTKNIIRAQKKQKTKAVSLITLADKSSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAIVFANSGKR
                                                      TSSGPSEGKSTTSANLAIVFANSGKR
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLLVDADMRKPTVAKTFTLDNARGLSTLLGSRETMLHQVVQPSGVDNLFLMASGPKPPNPSELLDSRRMQELLQELKHQY
VLLVDADMRKPTVAKTFTLDNARGLSTLLGSRETMLHQVVQPSGVDNLFLMASGPKPPNPSELLDSRRMQELLQELKHQY
 LLVDADMR                                                                       
       170       180       190       200       210       220       230    
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....
DLVIFDMPPVVAVTDAQIVSSKSDGTILVVRENVSKRDSLLKAKSLLELVDANILGVVYNGSKSIEDQGYYYGS
DLVIFDMPPVVAVTDAQIVSSKSDGTILVVRENVSKRDSLLKAKSLLELVDANILGVVYNGSKSIEDQGYYYGS
  VIFDMPP                                                            YYY  
© 1998-2020Legal notice