BYKdb

Annotate results for A0A1E5GGN9

A0A1E5GGN9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E5GGN9
DOMAINcd54/233TSSGPSEGKSTTSANLAIVFANSGKRVLLVDADMRKPTVAKTFSLDNVRGLSTLLGSRET
VLHQVVQSSGVDNLFLITSGPKPPNPSELLDSRRMKELMVELKQQYDLVIFDLPPVVAVT
DAQIVSSKSDGTILVVRENVSKRDSLLKAKNLLELVDANILGVVYNGSKNIADQGYYYGS
SITEWalker A61/63GKS
SITEWalker A'81/88LLVDADMR
SITEWalker B162/168VIFDLPP
SITEY Cluster229/231YYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTNKIRPQKKQKTKAVSLITLADKSSPISEQYRTIRTNIQYAMVDRDLKTLVITSSGPSEGKSTTSANLAIVFANSGKRV
                                                     TSSGPSEGKSTTSANLAIVFANSGKRV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLVDADMRKPTVAKTFSLDNVRGLSTLLGSRETVLHQVVQSSGVDNLFLITSGPKPPNPSELLDSRRMKELMVELKQQYD
LLVDADMRKPTVAKTFSLDNVRGLSTLLGSRETVLHQVVQSSGVDNLFLITSGPKPPNPSELLDSRRMKELMVELKQQYD
LLVDADMR                                                                        
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
LVIFDLPPVVAVTDAQIVSSKSDGTILVVRENVSKRDSLLKAKNLLELVDANILGVVYNGSKNIADQGYYYGS
LVIFDLPPVVAVTDAQIVSSKSDGTILVVRENVSKRDSLLKAKNLLELVDANILGVVYNGSKNIADQGYYYGS
 VIFDLPP                                                            YYY  
© 1998-2020Legal notice