BYKdb

Annotate results for A0A1E5AJN5

A0A1E5AJN5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E5AJN5
DOMAINtad35/292LLTDPVRLFMTAVSYSWLIIACAISGLVMGSVYASLQTKQYRASLQINIDVGRASALREF
EVVGESRSFFVTAESTIAASIRTRRLARRVVYELNLTEKPNFYIQPVRFSLVGILKRAIT
GRAEQPFIPRTYDERERAAINRVLAGMQITTLRRSPIVRIAFVHNERSYPHVVVNQIARS
FIELSVDQKAESANKIRLLLQGQADLVKQQLTSAERELNDYAKSISFTDLEEQPAILASR
LSAVNDALNAAVQDRLEL
DOMAINcd548/743TSSEPSEGKSITSYKIAEGFAKLGKRVILIDADLRRPKLHKWFGVANTLGLSTILADEVT
PEDEADLYIESGQKNLVFMRAGNIPPNPTDLLGSNNMARLVHRLTKEFDLVIIDGPPVMG
LADAPILARHTAATLYVVAANQATRPSVRHAINRLRASNVNLIGTVLTKFRLRRFDYNYA
YSYARSDYYTYNPTET
SITEWalker A555/557GKS
SITEWalker A'575/582ILIDADLR
SITEWalker B658/664VIIDGPP
SITEY Cluster724/738YNYAYSYARSDYYTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MADQQHSHSSNPGPVFLPGEASGTGNFVPSLGGSLLTDPVRLFMTAVSYSWLIIACAISGLVMGSVYASLQTKQYRASLQ
                                  LLTDPVRLFMTAVSYSWLIIACAISGLVMGSVYASLQTKQYRASLQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
INIDVGRASALREFEVVGESRSFFVTAESTIAASIRTRRLARRVVYELNLTEKPNFYIQPVRFSLVGILKRAITGRAEQP
INIDVGRASALREFEVVGESRSFFVTAESTIAASIRTRRLARRVVYELNLTEKPNFYIQPVRFSLVGILKRAITGRAEQP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FIPRTYDERERAAINRVLAGMQITTLRRSPIVRIAFVHNERSYPHVVVNQIARSFIELSVDQKAESANKIRLLLQGQADL
FIPRTYDERERAAINRVLAGMQITTLRRSPIVRIAFVHNERSYPHVVVNQIARSFIELSVDQKAESANKIRLLLQGQADL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VKQQLTSAERELNDYAKSISFTDLEEQPAILASRLSAVNDALNAAVQDRLELGLIVQQITEGKAPSLSAVLESQAIEGLK
VKQQLTSAERELNDYAKSISFTDLEEQPAILASRLSAVNDALNAAVQDRLEL                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRLATLRADYQDKLSIYKPDFPEMVRLAGQIEDTQNQLAKEISIISDSFVLRLAQAQQREETLRQELALVTASSREYREK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVEFIILRREVDSKRSQFEALIEKLNNIGVGAELRSENVAVLDYAVRTPDFFSPRRSRIVVAAMAVMIMLSIVIIFILEL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
INNRFSNPDQIESELELPLLGIVPFSDAGDDLHALDELDPALEEAYSSLRSAIQFSAIGGNLPSLSVTSSEPSEGKSITS
                                                                   TSSEPSEGKSITS
                                                                          GKS   
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YKIAEGFAKLGKRVILIDADLRRPKLHKWFGVANTLGLSTILADEVTPEDEADLYIESGQKNLVFMRAGNIPPNPTDLLG
YKIAEGFAKLGKRVILIDADLRRPKLHKWFGVANTLGLSTILADEVTPEDEADLYIESGQKNLVFMRAGNIPPNPTDLLG
              ILIDADLR                                                          
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNNMARLVHRLTKEFDLVIIDGPPVMGLADAPILARHTAATLYVVAANQATRPSVRHAINRLRASNVNLIGTVLTKFRLR
SNNMARLVHRLTKEFDLVIIDGPPVMGLADAPILARHTAATLYVVAANQATRPSVRHAINRLRASNVNLIGTVLTKFRLR
                 VIIDGPP                                                        
       730       740   
....:....|....:....|...
RFDYNYAYSYARSDYYTYNPTET
RFDYNYAYSYARSDYYTYNPTET
   YNYAYSYARSDYYTY     

© 1998-2020Legal notice