BYKdb

Annotate results for A0A1E4UZA0

A0A1E4UZA0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E4UZA0
DOMAINcd94/270TSPTPEAGKTVVAINLAMSIAHHTTKTALLVDFDLRRPKVGAYLGLPMEQSLNDLLSGEA
ELQDVLVNPSLPRFVVLPTRKSVSHSTEVLSSVAVGNLITDLRERYDSRIVIFDLPPLLS
CDDAIAVLPKIDCVLLVVANGMNSKKEIEDCLHHLPAANLIGTVLNKIEIEPRTYSY
SITEWalker A101/103GKT
SITEWalker A'122/129LLVDFDLR
SITEWalker B204/210VIFDLPP
SITEY Cluster268/270YSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MERIKQAIEKAKKQASSGFIAKPQASSAVAQPLAELGALNYVQTKVISLRAELLERNRIVAYNKNSNMSWSFDLLRTQVL


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KIMEENGWRTLAITSPTPEAGKTVVAINLAMSIAHHTTKTALLVDFDLRRPKVGAYLGLPMEQSLNDLLSGEAELQDVLV
             TSPTPEAGKTVVAINLAMSIAHHTTKTALLVDFDLRRPKVGAYLGLPMEQSLNDLLSGEAELQDVLV
                    GKT                  LLVDFDLR                               
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPSLPRFVVLPTRKSVSHSTEVLSSVAVGNLITDLRERYDSRIVIFDLPPLLSCDDAIAVLPKIDCVLLVVANGMNSKKE
NPSLPRFVVLPTRKSVSHSTEVLSSVAVGNLITDLRERYDSRIVIFDLPPLLSCDDAIAVLPKIDCVLLVVANGMNSKKE
                                           VIFDLPP                              
       250       260       270
....:....|....:....|....:....|
IEDCLHHLPAANLIGTVLNKIEIEPRTYSY
IEDCLHHLPAANLIGTVLNKIEIEPRTYSY
                           YSY
© 1998-2020Legal notice