BYKdb

Annotate results for A0A1E4R4B2

A0A1E4R4B2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E4R4B2
DOMAINcd52/232TSSIAGEGKSTNAANIGVVFSQEGKRVLIIDADMRKPTLHHTFYLDNIFGLSSVLSRQAT
LQEVIQETFVEGVDIISSGAIPPNPTELLASETMTFLLHEVKERYDIVMIDAPPLLFLSD
AQILSNKCDGTLLVVNTGAVGKAAVVKSKSILTISKANILGVILNNYKMKGSTYEQYYGK
E
SITEWalker A59/61GKS
SITEWalker A'79/86LIIDADMR
SITEWalker B159/165VMIDAPP
SITEY Cluster225/229YEQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLFKRKTKRIPMARKLITVSDMMSIPSEQYRTIRANIKFSQPNQDVKTILVTSSIAGEGKSTNAANIGVVFSQEGKRVLI
                                                   TSSIAGEGKSTNAANIGVVFSQEGKRVLI
                                                          GKS                 LI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDADMRKPTLHHTFYLDNIFGLSSVLSRQATLQEVIQETFVEGVDIISSGAIPPNPTELLASETMTFLLHEVKERYDIVM
IDADMRKPTLHHTFYLDNIFGLSSVLSRQATLQEVIQETFVEGVDIISSGAIPPNPTELLASETMTFLLHEVKERYDIVM
IDADMR                                                                        VM
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
IDAPPLLFLSDAQILSNKCDGTLLVVNTGAVGKAAVVKSKSILTISKANILGVILNNYKMKGSTYEQYYGKE
IDAPPLLFLSDAQILSNKCDGTLLVVNTGAVGKAAVVKSKSILTISKANILGVILNNYKMKGSTYEQYYGKE
IDAPP                                                           YEQYY   
© 1998-2020Legal notice