BYKdb

Annotate results for A0A1E4N813

A0A1E4N813 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E4N813
DOMAINtad11/173ERLDLAAVTSRYRRHVGPILACTAVGAILFGGLTYFLPNRYTAVTEMTYAPQVPPDVSQN
SSAVPAPLSDQQRDSRIDAAVQGIQSLPVAVRVVTALKLERDPQLADKAKKYLTGGNVRE
AVAAALLDSLKVKRVSETPLIDISFTHADPLQAAKISDAFGKA
DOMAINcd510/697TSALPKEGKTTTAINMARTQAMAGERVLLMDCDLRRRSVTTLLAPDAKIGLNQVINGTAA
LEEAISVDSTGLHLLQLAPQSHIGPQPFGTPAFDELMGKLREEYDLIVIDTAPVLAVVDV
RLLLPHIDALGLLTRWRQTPVRATRAAIHQLETVGGRVDGIALSLVDANAQAHVGYGDAS
QYYTEMKE
SITEWalker A517/519GKT
SITEWalker A'537/544LLMDCDLR
SITEWalker B616/622IVIDTAP
SITEY Cluster685/699YGDASQYYTEMKEYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MASMGGIRDEERLDLAAVTSRYRRHVGPILACTAVGAILFGGLTYFLPNRYTAVTEMTYAPQVPPDVSQNSSAVPAPLSD
          ERLDLAAVTSRYRRHVGPILACTAVGAILFGGLTYFLPNRYTAVTEMTYAPQVPPDVSQNSSAVPAPLSD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQRDSRIDAAVQGIQSLPVAVRVVTALKLERDPQLADKAKKYLTGGNVREAVAAALLDSLKVKRVSETPLIDISFTHADP
QQRDSRIDAAVQGIQSLPVAVRVVTALKLERDPQLADKAKKYLTGGNVREAVAAALLDSLKVKRVSETPLIDISFTHADP

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LQAAKISDAFGKAYEDQQSADNTALSQSSSNRMDASMVQMAQQARDADAAVARFKLEHRVEFDPKSPAIGQDIAMLASSL
LQAAKISDAFGKA                                                                   

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GMAQAQLGEARARASFVRQGGMNDQFATNSPLTPLRDQQAQVSRNLASLQSRYGSMHPKVIEAQKELDSINNQVRSETVR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSDQAYASVRFEEQKVKALSSALAEARNRQINQIAAATQLEGLQRQAETANTLYNNMLSNSTQEVAKRAVLPPDTTITMR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASPPMRPSFPILPLNIAIGLILGFAAGIGIAFFRERWSIGIDNNGDIERLLGKTYLNSLPTLTSAIDRPTTKDPVEALTA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HPLSLYAEAYRSLATNLRMSDQNVKVIAVTSALPKEGKTTTAINMARTQAMAGERVLLMDCDLRRRSVTTLLAPDAKIGL
                             TSALPKEGKTTTAINMARTQAMAGERVLLMDCDLRRRSVTTLLAPDAKIGL
                                    GKT                 LLMDCDLR                
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQVINGTAALEEAISVDSTGLHLLQLAPQSHIGPQPFGTPAFDELMGKLREEYDLIVIDTAPVLAVVDVRLLLPHIDALG
NQVINGTAALEEAISVDSTGLHLLQLAPQSHIGPQPFGTPAFDELMGKLREEYDLIVIDTAPVLAVVDVRLLLPHIDALG
                                                       IVIDTAP                  
       650       660       670       680       690       700  
....:....|....:....|....:....|....:....|....:....|....:....|..
LLTRWRQTPVRATRAAIHQLETVGGRVDGIALSLVDANAQAHVGYGDASQYYTEMKEYYATA
LLTRWRQTPVRATRAAIHQLETVGGRVDGIALSLVDANAQAHVGYGDASQYYTEMKE     
                                            YGDASQYYTEMKEYY   

© 1998-2020Legal notice