BYKdb

Annotate results for A0A1E4N4Q9

A0A1E4N4Q9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E4N4Q9
DOMAINtad30/199NGITMSEIRAMLYRQRKLIFPTIVAGPVLALGVTWMMPAIYEGTVSVKIDNERAKILEGQ
DLDPTVTTSDTGRYLATQASIVTSRSLATQVADEMALARDDRFLLSMGKKVKNDGLSKKD
ADAARREQVITLLQQTVKMATPTDNRVATISFRSRNPQIAAQVANTYADK
DOMAINcd532/724TSSSPAEGKSTTAYALAQDFARAGRRVLLVDADTRAPSQHRLLKHARNLSGLTDSIVHQK
PFTETIHQSETPDLYFMPLGARPANPAHLLSSDVIAPFLNRLKEMFDVVIVDAPPVMGLA
DALLLARHMDAVIFIAEAGRAHNGQAKIALRRLRDNGAHVLGAVLTKFNPVESGYGQSTG
YYYYYNYRYERAL
SITEWalker A539/541GKS
SITEWalker A'559/566LLVDADTR
SITEWalker B640/646VIVDAPP
SITEY Cluster706/720YGQSTGYYYYYNYRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MANAQEPSLATSLIDRFLPNFSSAEPLENNGITMSEIRAMLYRQRKLIFPTIVAGPVLALGVTWMMPAIYEGTVSVKIDN
                             NGITMSEIRAMLYRQRKLIFPTIVAGPVLALGVTWMMPAIYEGTVSVKIDN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERAKILEGQDLDPTVTTSDTGRYLATQASIVTSRSLATQVADEMALARDDRFLLSMGKKVKNDGLSKKDADAARREQVIT
ERAKILEGQDLDPTVTTSDTGRYLATQASIVTSRSLATQVADEMALARDDRFLLSMGKKVKNDGLSKKDADAARREQVIT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLQQTVKMATPTDNRVATISFRSRNPQIAAQVANTYADKYIGQNVLQRYEMNAYARKILKNQVTQTQQELRAAEQKAIDY
LLQQTVKMATPTDNRVATISFRSRNPQIAAQVANTYADK                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARQYHLIDIGDAASGADEGKGNGGTKDTGNGRSIVTANLVAINDAYAAALDLPEGRNSPSIQGLMQSRAATASQLAQLRK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYAANRPEVQEAAAQLASIESQIATVGQNIRASIRAEYLGALHKEQELAKSRSDLSAQSLGEQERRVQLNLIVRDADTLR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQLGDLLTRLNQIESAADVDTNNIAIIDKARVPDDPVSPIMWRNLLIGLVAGVTLAISTALLRELFDETLQRPEDVEDKL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLPLLGVVPATLTNVLDSLNDGKSGLAEAYYSVRSTIDYASGGDVKKLILITSSSPAEGKSTTAYALAQDFARAGRRVLL
                                                   TSSSPAEGKSTTAYALAQDFARAGRRVLL
                                                          GKS                 LL
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDADTRAPSQHRLLKHARNLSGLTDSIVHQKPFTETIHQSETPDLYFMPLGARPANPAHLLSSDVIAPFLNRLKEMFDVV
VDADTRAPSQHRLLKHARNLSGLTDSIVHQKPFTETIHQSETPDLYFMPLGARPANPAHLLSSDVIAPFLNRLKEMFDVV
VDADTR                                                                         V
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVDAPPVMGLADALLLARHMDAVIFIAEAGRAHNGQAKIALRRLRDNGAHVLGAVLTKFNPVESGYGQSTGYYYYYNYRY
IVDAPPVMGLADALLLARHMDAVIFIAEAGRAHNGQAKIALRRLRDNGAHVLGAVLTKFNPVESGYGQSTGYYYYYNYRY
IVDAPP                                                           YGQSTGYYYYYNYRY
       730
....:....|
ERALPEGETA
ERAL      

© 1998-2020Legal notice