BYKdb

Annotate results for A0A1E4MC73

A0A1E4MC73 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E4MC73
DOMAINtad14/170FSDFVQSAQDTLRRRWLTLVIVTVAITVAGVAGISLITPRYTAAALIRIDPSRNPLNNKQ
PQEALSPESIETEVAVLSSTELAQRVVKALKLENDPELLESVRKAGNVSGDRDAALASAL
LDRLSVSRDKLTYLISVGYTSEDPQKAARVANAVAEG
DOMAINcd512/701TSALPSEGKTTSSLSFARTLALNGSRVILVDCDVRRAQVRHIVENPGSGPGLVEVLHGTA
SEAEAIHPGDVEGMDQLLVSAPYFSSEDLFGSDGMVTLLNKLSDRYDFVVLDLPPLVGLA
DGRFLAAMADATVLAVRWASTPPQAAASAVNWLQSDGSNPIGVIYTMVDSAAEAIGGLYY
SKKYTQYYRA
SITEWalker A519/521GKT
SITEWalker A'539/546ILVDCDVR
SITEWalker B620/626VVLDLPP
SITEY Cluster690/699YYSKKYTQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEVTHQNEAPAGRFSDFVQSAQDTLRRRWLTLVIVTVAITVAGVAGISLITPRYTAAALIRIDPSRNPLNNKQPQEALSP
             FSDFVQSAQDTLRRRWLTLVIVTVAITVAGVAGISLITPRYTAAALIRIDPSRNPLNNKQPQEALSP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESIETEVAVLSSTELAQRVVKALKLENDPELLESVRKAGNVSGDRDAALASALLDRLSVSRDKLTYLISVGYTSEDPQKA
ESIETEVAVLSSTELAQRVVKALKLENDPELLESVRKAGNVSGDRDAALASALLDRLSVSRDKLTYLISVGYTSEDPQKA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARVANAVAEGYLDLKVNTSTGTAARQADWFREQLDKLAAEMRAADEQVAQYRAQAGLAQGSGSNAGTIVDQQVGPLSSQL
ARVANAVAEG                                                                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AMAESDAAAARAALSTAERQIQRGNLDSVEQVRNSPVINDLRRQRAEILRNQGEVEARYGPRHPESIRVRDQLASIDQQI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDEAERAVASLRANTTAVEARAGSLRSTMGRVAGEQASNTRAAVIADSLERDAAAKRAAYDRMSQMWLESTQASQNQISQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVIVNRADVPTKPTFPKRLLMSVLSLVVGLAAGIATIIFQEMMVRGLRTIDDVESTLGLPVLAAVPKLPRSSNPGRTLLE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPTSLFSESFRIARAAILGVKSAKPPKIIAFTSALPSEGKTTSSLSFARTLALNGSRVILVDCDVRRAQVRHIVENPGSG
                               TSALPSEGKTTSSLSFARTLALNGSRVILVDCDVRRAQVRHIVENPGSG
                                      GKT                 ILVDCDVR              
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PGLVEVLHGTASEAEAIHPGDVEGMDQLLVSAPYFSSEDLFGSDGMVTLLNKLSDRYDFVVLDLPPLVGLADGRFLAAMA
PGLVEVLHGTASEAEAIHPGDVEGMDQLLVSAPYFSSEDLFGSDGMVTLLNKLSDRYDFVVLDLPPLVGLADGRFLAAMA
                                                           VVLDLPP              
       650       660       670       680       690       700   
....:....|....:....|....:....|....:....|....:....|....:....|...
DATVLAVRWASTPPQAAASAVNWLQSDGSNPIGVIYTMVDSAAEAIGGLYYSKKYTQYYRAAA
DATVLAVRWASTPPQAAASAVNWLQSDGSNPIGVIYTMVDSAAEAIGGLYYSKKYTQYYRA  
                                                 YYSKKYTQYY    

© 1998-2020Legal notice