BYKdb

Annotate results for A0A1E4L9V9

A0A1E4L9V9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E4L9V9
DOMAINtad47/231DEIDLLAYWRILVKRRRLIASVLAGVVAIALLATLTATPIYRATTVLQLDKEGIQVVQVD
GIQPGDDRGFDPAFLQTQYELIKSRSLAERVANELGLDRAALERLSEPGWLGRMLALLKP
KGRQEETGRTASAGGDAAAELRDAAKLIGDSLSIEPVRNSRLVKINFDSPSPQFSARAAN
AIAEG
DOMAINcd565/757TSSGPGEGKSTTALALARNLTQLGKRVLLVDADLRKPSLHKTLGLKAESGLSHLLAGGCT
FGAAVQHTEDERLHVILAGPLPPNPAELLSGSKLVSLLTVGTERYDHVIIDGPPVLGLAD
APILANAIDGTLLVINSAKTKIGAAQAALKRLYAARARILGGLLTKYDARAAGYGYGYGY
GGAYAYYSYGDKP
SITEWalker A572/574GKS
SITEWalker A'592/599LLVDADLR
SITEWalker B672/678VIIDGPP
SITEY Cluster738/753YGYGYGYGGAYAYYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTEEHLPAGPADDHRRLPARTGTGAVDLHRGGTALVLDTQEERRDDDEIDLLAYWRILVKRRRLIASVLAGVVAIALLAT
                                              DEIDLLAYWRILVKRRRLIASVLAGVVAIALLAT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTATPIYRATTVLQLDKEGIQVVQVDGIQPGDDRGFDPAFLQTQYELIKSRSLAERVANELGLDRAALERLSEPGWLGRM
LTATPIYRATTVLQLDKEGIQVVQVDGIQPGDDRGFDPAFLQTQYELIKSRSLAERVANELGLDRAALERLSEPGWLGRM

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LALLKPKGRQEETGRTASAGGDAAAELRDAAKLIGDSLSIEPVRNSRLVKINFDSPSPQFSARAANAIAEGYIASGLERR
LALLKPKGRQEETGRTASAGGDAAAELRDAAKLIGDSLSIEPVRNSRLVKINFDSPSPQFSARAANAIAEG         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGASSYAKTYLEDQLKLTKAKLEESERKLVQFAQQENLINTGENGQSLAVQNLTQLNAALAAAQDQRIRAQARWRQASSG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AMPADMIGNSNIRVLQQQKGQLQSQYQLKLQTFKPDYPEMQQLKSQIDELDRQIAKEIAGVRASVKAEYDAAAAQEQMLS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQIAALRTQALDVDGRSIQYNILKREVDTNRQLYDGLLQRFKEVGVAGDVRANNISIIDRAEVPRWRFKPNLTLNLAIGL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLGAMLGVLAAFLLEFLDDTIKTPDDVEHKLRLPVLGIIPKLGPKDNLSEVASDLQSSFSEAYRSVRTALQFATDHGVPK


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLLVTSSGPGEGKSTTALALARNLTQLGKRVLLVDADLRKPSLHKTLGLKAESGLSHLLAGGCTFGAAVQHTEDERLHVI
    TSSGPGEGKSTTALALARNLTQLGKRVLLVDADLRKPSLHKTLGLKAESGLSHLLAGGCTFGAAVQHTEDERLHVI
           GKS                 LLVDADLR                                         
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAGPLPPNPAELLSGSKLVSLLTVGTERYDHVIIDGPPVLGLADAPILANAIDGTLLVINSAKTKIGAAQAALKRLYAAR
LAGPLPPNPAELLSGSKLVSLLTVGTERYDHVIIDGPPVLGLADAPILANAIDGTLLVINSAKTKIGAAQAALKRLYAAR
                               VIIDGPP                                          
       730       740       750       760  
....:....|....:....|....:....|....:....|..
ARILGGLLTKYDARAAGYGYGYGYGGAYAYYSYGDKPRLTKG
ARILGGLLTKYDARAAGYGYGYGYGGAYAYYSYGDKP     
                 YGYGYGYGGAYAYYSY         

© 1998-2020Legal notice