BYKdb

Annotate results for A0A1E4K2K4

A0A1E4K2K4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E4K2K4
DOMAINtad31/210ERLNLLGYWQILLKRKWLLLSVLASVLSVVLVKTLLTPPVFRASATLQIDQDTIKIVQSE
GVAPAEGVGDRDYYQTQYELLRSRSLAERVAAGMGAGQIRLAAAAQRAPGLWARLAGETA
VTADAAEEAEPPEPSRDDLASYVQRHLSVEPVRNSRLVRIQFDSLDPGFSATMANAIADA
DOMAINcd544/733TSSAPGEGKSTTALTLALHFAQLGKRVLLIDADLRNPTLHQALRVPNAAGLSNYLSGASR
PLKFLHPTQVKNLACLCSGPLPPNPAELLAGPRLVTLLRLAAASFDQVIIDGPPMLGIAD
AAILSNLAGGTILVIEAGSTRLGHARGVLKRLNAARARVLGVVLTKLDPRHGGAVYGYGG
YNYYAYGGQP
SITEWalker A551/553GKS
SITEWalker A'571/578LLIDADLR
SITEWalker B651/657VIIDGPP
SITEY Cluster719/729YGYGGYNYYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPRRRDAALQPAAVPQLPAAAIAAADGGDEERLNLLGYWQILLKRKWLLLSVLASVLSVVLVKTLLTPPVFRASATLQID
                              ERLNLLGYWQILLKRKWLLLSVLASVLSVVLVKTLLTPPVFRASATLQID

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDTIKIVQSEGVAPAEGVGDRDYYQTQYELLRSRSLAERVAAGMGAGQIRLAAAAQRAPGLWARLAGETAVTADAAEEAE
QDTIKIVQSEGVAPAEGVGDRDYYQTQYELLRSRSLAERVAAGMGAGQIRLAAAAQRAPGLWARLAGETAVTADAAEEAE

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPEPSRDDLASYVQRHLSVEPVRNSRLVRIQFDSLDPGFSATMANAIADAFIATHIDRRFDASAYAKNYLEERLQQLKLK
PPEPSRDDLASYVQRHLSVEPVRNSRLVRIQFDSLDPGFSATMANAIADA                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEDSEKQLVQFAQQQGIVSIDQQQSPAAQELQSINASLAAAQQQRIEAEAKYRRSQTTPADALPEVLLSSIVGQLKNRRT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELLGQYQEKLQIFKPGYPAMEQLKGQIEEIDRQLAGEIGRIKNAVRSEFEAARSAESMLGLRLAELKAQLLDLQGRSIQY


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NIIKREVDTNRELYDGLLQRYKEIGVAGGITANNISVVDRARAPAGRFSPNLGRSLLLGLFAGLAAGIFLALLFEHLDDT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKSPEDVEQKFGLAILGLIPRLQRGSPLEALKDPRSPFSESYRSVRTALQFSTEAGVPRTLFVTSSAPGEGKSTTALTLA
                                                               TSSAPGEGKSTTALTLA
                                                                      GKS       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LHFAQLGKRVLLIDADLRNPTLHQALRVPNAAGLSNYLSGASRPLKFLHPTQVKNLACLCSGPLPPNPAELLAGPRLVTL
LHFAQLGKRVLLIDADLRNPTLHQALRVPNAAGLSNYLSGASRPLKFLHPTQVKNLACLCSGPLPPNPAELLAGPRLVTL
          LLIDADLR                                                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRLAAASFDQVIIDGPPMLGIADAAILSNLAGGTILVIEAGSTRLGHARGVLKRLNAARARVLGVVLTKLDPRHGGAVYG
LRLAAASFDQVIIDGPPMLGIADAAILSNLAGGTILVIEAGSTRLGHARGVLKRLNAARARVLGVVLTKLDPRHGGAVYG
          VIIDGPP                                                             YG
       730       740   
....:....|....:....|...
YGGYNYYAYGGQPKLEAPRARRA
YGGYNYYAYGGQP          
YGGYNYYAY              

© 1998-2020Legal notice