BYKdb

Annotate results for A0A1E4JHX8

A0A1E4JHX8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E4JHX8
DOMAINcd398/585TSTRPAEGKSTTAYAIAHALARSKQKVVLIDADMRSPSVHHLFSIGNERGLSNYLAGSEQ
LDELISSSSLAGLSIITAGPQPPNAAELLTGQRLEQLLTALLTRFDHVVVDSPPVMGLAD
APLIASRVEGVVFAVESHGIKASMVRVALGRLAAANAHVLGTVLTKFESKRSYFGYGYDY
GYGYGQTS
SITEWalker A405/407GKS
SITEWalker A'425/432VLIDADMR
SITEWalker B505/511VVVDSPP
SITEY Cluster570/581YFGYGYDYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRNTPAGREKRSREAARILLENIDIVPDRLSRLVTITFTSPDPKLSARVANAWTANFIESNLERRFEATSYARKFLEERL


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQWRERLEESERVLVAYASDEKIINLPAAGATRDGPTVERSIVADDLASLNAELSAAKGEMVRAHSRVTEVGANGAVEEA


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LTNNAITGIRQKRAEVAAEYARLLSQFEPEYPEVKALATQLSQLDRSIASEENRIRTSLQQSYQASVARVGDLEGRVSNL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSSFLDLRRRSIQYNIYQREADTNRQLYDALLQRYKEIGVAGGVGTNNVSVVDVARIPERPSRPSLILNMLVALILGAGI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAALAFALEHIDEAISDPQEIADLLGLPVLGIVPKAATESPIEALGDRKSPMVEAYLSVQTNLAFSTNHGVPKTLSVTST
                                                                             TST

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RPAEGKSTTAYAIAHALARSKQKVVLIDADMRSPSVHHLFSIGNERGLSNYLAGSEQLDELISSSSLAGLSIITAGPQPP
RPAEGKSTTAYAIAHALARSKQKVVLIDADMRSPSVHHLFSIGNERGLSNYLAGSEQLDELISSSSLAGLSIITAGPQPP
    GKS                 VLIDADMR                                                
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NAAELLTGQRLEQLLTALLTRFDHVVVDSPPVMGLADAPLIASRVEGVVFAVESHGIKASMVRVALGRLAAANAHVLGTV
NAAELLTGQRLEQLLTALLTRFDHVVVDSPPVMGLADAPLIASRVEGVVFAVESHGIKASMVRVALGRLAAANAHVLGTV
                        VVVDSPP                                                 
       570       580         
....:....|....:....|....:....
LTKFESKRSYFGYGYDYGYGYGQTSKAES
LTKFESKRSYFGYGYDYGYGYGQTS    
         YFGYGYDYGYGY        
© 1998-2020Legal notice