BYKdb

Annotate results for A0A1E4FAX3

A0A1E4FAX3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E4FAX3
DOMAINtad12/185QYVDMRAILDVLRRRAPLILGVLVVGLALSSLVVFSLKPAYTASALVMVDPTRKDLLDPN
GIQGAAGSGDSARIDSEVEIANSTPVLLRAIDDAKLMEEPHLAPMPGLRARLLALLRIAE
PAMPTGQAARNAVLRNLDATVSARRRGFTYLIAISAEASTPDGAARIANAVAEA
DOMAINcd484/673TSSVPFEGKTTTAIGLARVYAASGLKVLLVDGDMRRPAVHQQLDIRPSGGLFDYLAGNSK
DAVPVSMLSQDPLSEAAVLVGTRHGEAGSEQLLTSTAFLRLVSAARETFDVIIIDTPPVG
VVVDGIYLLDMADAVLFVVRWGSTAQQDTVRALDAVESAKRADVPVVLAINQQKLARRRY
RGGYYGPETG
SITEWalker A491/493GKT
SITEWalker A'511/518LLVDGDMR
SITEWalker B595/601IIIDTPP
SITEY Cluster663/668YRGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLARRGGGMGDQYVDMRAILDVLRRRAPLILGVLVVGLALSSLVVFSLKPAYTASALVMVDPTRKDLLDPNGIQGAAGSG
           QYVDMRAILDVLRRRAPLILGVLVVGLALSSLVVFSLKPAYTASALVMVDPTRKDLLDPNGIQGAAGSG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSARIDSEVEIANSTPVLLRAIDDAKLMEEPHLAPMPGLRARLLALLRIAEPAMPTGQAARNAVLRNLDATVSARRRGFT
DSARIDSEVEIANSTPVLLRAIDDAKLMEEPHLAPMPGLRARLLALLRIAEPAMPTGQAARNAVLRNLDATVSARRRGFT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLIAISAEASTPDGAARIANAVAEAYIRVQVQSKVQSVMDALDMLVPRLAEASAALAASESALDLMVGGNLDRLVAESDR
YLIAISAEASTPDGAARIANAVAEA                                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDIAKLQQELDAVLSERARMGAALEALERGSGEGMGQTSPADIREDAAALLRVELAANRSLAAQLRDDMRSAMLDGALPP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVLTDIYEMQQAAALARTNYERLIGRVNDLRAQADLQVADSRVAAAATPPERASFPNVRMMLFVAGVALLGIGAALAFIV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ENFIGGFTSEAQLEAVTRRKVASVIPQQKPAKRADGAPANSAADSVVAAPLSPFAESLRRLRLRVDQGLARGVGSGRGMV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVVTSSVPFEGKTTTAIGLARVYAASGLKVLLVDGDMRRPAVHQQLDIRPSGGLFDYLAGNSKDAVPVSMLSQDPLSEAA
   TSSVPFEGKTTTAIGLARVYAASGLKVLLVDGDMRRPAVHQQLDIRPSGGLFDYLAGNSKDAVPVSMLSQDPLSEAA
          GKT                 LLVDGDMR                                          
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLVGTRHGEAGSEQLLTSTAFLRLVSAARETFDVIIIDTPPVGVVVDGIYLLDMADAVLFVVRWGSTAQQDTVRALDAVE
VLVGTRHGEAGSEQLLTSTAFLRLVSAARETFDVIIIDTPPVGVVVDGIYLLDMADAVLFVVRWGSTAQQDTVRALDAVE
                                  IIIDTPP                                       
       650       660       670   
....:....|....:....|....:....|...
SAKRADVPVVLAINQQKLARRRYRGGYYGPETG
SAKRADVPVVLAINQQKLARRRYRGGYYGPETG
                      YRGGYY     
© 1998-2020Legal notice