BYKdb

Annotate results for A0A1E4BP96

A0A1E4BP96 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E4BP96
DOMAINcd237/425TSPLPGDGKSTTAANLAMSLAAAGQRVVLIDGDLRQPVVASLFDLPEGAGLTDILAGRAT
TGDVVQPVQGSQNLYILASGRVPPNPSEVLGSRRMRDLVTSLTEHALVIVDSPPTLLVAD
AAVLSRVTDGALLVTSAGRTTHEMLQRSLENIAKVNGRLLGVVLNKATRRGRPDYGYAYG
SGAADTRPA
SITEWalker A244/246GKS
SITEWalker A'264/271VLIDGDLR
SITEWalker B344/350VIVDSPP
SITEY Cluster411/415YGYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MYTASASGYVSGASLAAETGSPLVGDQLARSKVTSYLDIGSWRAVAEHAIEDLGLSASPESLVGNVTVSNPLDTVVIHVA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATAATPESARDLAEAWIRGMTAAIDDIEGTGVAGSAPVTLIPGDSARLPTAPSSPNTTLNLALGGLVGLALGIAYAVMRS


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLDSRIREPQDVERNTGASVVGVLPLDHDLDNRREVLSFTGASGNVVRGALTEAIRELRTNLQFMDVDDPPRSIVVTSPL
                                                                            TSPL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PGDGKSTTAANLAMSLAAAGQRVVLIDGDLRQPVVASLFDLPEGAGLTDILAGRATTGDVVQPVQGSQNLYILASGRVPP
PGDGKSTTAANLAMSLAAAGQRVVLIDGDLRQPVVASLFDLPEGAGLTDILAGRATTGDVVQPVQGSQNLYILASGRVPP
   GKS                 VLIDGDLR                                                 
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPSEVLGSRRMRDLVTSLTEHALVIVDSPPTLLVADAAVLSRVTDGALLVTSAGRTTHEMLQRSLENIAKVNGRLLGVVL
NPSEVLGSRRMRDLVTSLTEHALVIVDSPPTLLVADAAVLSRVTDGALLVTSAGRTTHEMLQRSLENIAKVNGRLLGVVL
                       VIVDSPP                                                  
       410       420         
....:....|....:....|....:....
NKATRRGRPDYGYAYGSGAADTRPAFVPR
NKATRRGRPDYGYAYGSGAADTRPA    
          YGYAY              
© 1998-2020Legal notice