BYKdb

Annotate results for A0A1E4BBP7

A0A1E4BBP7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E4BBP7
DOMAINtad41/266VGDQLARTLAAIKRYKWLVLAVIAVGSTAGVTLTRFVKPKYDVSASIWIAATPGPSGRMG
PVSAPGLVNSDVAWMELARSFSVLDKVVSKLALYVYPDVAADTLVVRDLYPSDSLQPGPY
RLTIQGSSYVLARPAQQRGEQDVVVERGAVGDSIGRAVGFQWQPSAQLLAGREQVGFYVV
TPREAAFNLGSQLSVTVGQNSNLMRFQLSGSKAGLLATTLNTLARE
DOMAINcd611/800SSPGPGDGKSFVSANLASALADSGYRTVIVDGDIRRGTLHDIFAPCAQAPGLVDYLAGEA
TLDEVLRPTQQHINLSIVPCGKRRRHGPELLASERMTTLIRDLRTQFDAIIVDTAPLGAG
IDPFAIGTATGSMVLVLRAGETDRKLAQAKLTVLDRMPIRLVGAILNDIGELPQFKYYYY
LEGYRALEGA
SITEWalker A618/620GKS
SITEWalker A'638/645VIVDGDIR
SITEWalker B720/726IIVDTAP
SITEY Cluster787/794YYYYLEGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSANLVPSAANAAAVPRQDGFAPMPQWGGAPSAPPPSQGGVGDQLARTLAAIKRYKWLVLAVIAVGSTAGVTLTRFVKPK
                                        VGDQLARTLAAIKRYKWLVLAVIAVGSTAGVTLTRFVKPK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDVSASIWIAATPGPSGRMGPVSAPGLVNSDVAWMELARSFSVLDKVVSKLALYVYPDVAADTLVVRDLYPSDSLQPGPY
YDVSASIWIAATPGPSGRMGPVSAPGLVNSDVAWMELARSFSVLDKVVSKLALYVYPDVAADTLVVRDLYPSDSLQPGPY

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RLTIQGSSYVLARPAQQRGEQDVVVERGAVGDSIGRAVGFQWQPSAQLLAGREQVGFYVVTPREAAFNLGSQLSVTVGQN
RLTIQGSSYVLARPAQQRGEQDVVVERGAVGDSIGRAVGFQWQPSAQLLAGREQVGFYVVTPREAAFNLGSQLSVTVGQN

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNLMRFQLSGSKAGLLATTLNTLAREFVSEAVRLKRENLTVSAEATEEQLQQAAQQLAAAQTALERFKINTITLPSEQMA
SNLMRFQLSGSKAGLLATTLNTLARE                                                      

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ITPGVSTTMNPVFQAYFSDRVNYEQVRRDREALERIVEEGRGRGGKISLEALRSVGSATASNTSLQAEIANLNQARGQLV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NLQKTYTDEYRMVKDLKQQIEVMESQSIPTLVASSLQELRSREAEMKRRIDGASQELKQIPARTVEEMRLNRELQIAQTM


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YVDLQQRAMSARLSERNALPDVSILDTAVAPRFPSSDTTLSIILVAIAASIGLGLALAILLDRLDKRFRYPEQATHELGL


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DIVGAIPTYRNPTSAAARLEEASQLIESFRTIALSVRSAFEGLGPVQLAVSSPGPGDGKSFVSANLASALADSGYRTVIV
                                                  SSPGPGDGKSFVSANLASALADSGYRTVIV
                                                         GKS                 VIV
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGDIRRGTLHDIFAPCAQAPGLVDYLAGEATLDEVLRPTQQHINLSIVPCGKRRRHGPELLASERMTTLIRDLRTQFDAI
DGDIRRGTLHDIFAPCAQAPGLVDYLAGEATLDEVLRPTQQHINLSIVPCGKRRRHGPELLASERMTTLIRDLRTQFDAI
DGDIR                                                                          I
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVDTAPLGAGIDPFAIGTATGSMVLVLRAGETDRKLAQAKLTVLDRMPIRLVGAILNDIGELPQFKYYYYLEGYRALEGA
IVDTAPLGAGIDPFAIGTATGSMVLVLRAGETDRKLAQAKLTVLDRMPIRLVGAILNDIGELPQFKYYYYLEGYRALEGA
IVDTAP                                                            YYYYLEGY      
       810        
....:....|....:...
EEGNAALLGSGSGGNGRG


© 1998-2020Legal notice