BYKdb

Annotate results for A0A1E4AI53

A0A1E4AI53 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E4AI53
DOMAINtad1/162MLRRRLWLIVITTLVVVGVAGGITATLKKVYSASALVLFDPSSKDLLADSAQMPNWSDTA
RVDSEVELARSDATISRVVEAYGLVKDDEFGVQISLWDKLLAFFRIAEPTMPSADALVKS
VTDQVSKAVSVRRNGLTYVMAFQATTQSPEKSAMLANALAET
DOMAINcd507/699ASSAPGEGKTTLALSLARTYALSGVPTLLIDCDLRKPGVHQQLGIAPSSGLLDYLAKGSD
APELTSIMVADDESGAQVIPGSRRSDIPTDQLLASASFARLVKAAQRSFDIVILDTAPVG
PVVDSLYIAPLADVVAFVVRWAATPQQDVKEAMQALSDAKSPGSELVAILSQQRSGIRGY
YNKSKYAGYYSDR
SITEWalker A514/516GKT
SITEWalker A'534/541LLIDCDLR
SITEWalker B618/624VILDTAP
SITEY Cluster686/696YYNKSKYAGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLRRRLWLIVITTLVVVGVAGGITATLKKVYSASALVLFDPSSKDLLADSAQMPNWSDTARVDSEVELARSDATISRVVE
MLRRRLWLIVITTLVVVGVAGGITATLKKVYSASALVLFDPSSKDLLADSAQMPNWSDTARVDSEVELARSDATISRVVE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AYGLVKDDEFGVQISLWDKLLAFFRIAEPTMPSADALVKSVTDQVSKAVSVRRNGLTYVMAFQATTQSPEKSAMLANALA
AYGLVKDDEFGVQISLWDKLLAFFRIAEPTMPSADALVKSVTDQVSKAVSVRRNGLTYVMAFQATTQSPEKSAMLANALA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETYIRMQLEGKIASVQTAYDVVTARIASAQTALEGSERAFDGFIDSNLDAIATATGSTKLADIRRQLSASVASADQMRST
ET                                                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTRASAALDRGDWTTVSNALASDAVQQYELRRQELEKSLAGAAEGSLGVVDLRAELAKVQQQLATEARQAVAGLQNGIAE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQARSTDLRTELRTTVQNSDLPAGLRTDLYRLLREGEIAKSQYDALLANQKDFDARTALQVPDSRIASPAVSPSDASFPN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRVILALAAAMGLGLGLALAFSLENFVGGFTDERQLEAVSGAKVVAAIPRLRPLRVNEQEATVSSYVPHAPLSVFAETVR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RARIGIDQALRRNRGTSPENGAVVMVASSAPGEGKTTLALSLARTYALSGVPTLLIDCDLRKPGVHQQLGIAPSSGLLDY
                          ASSAPGEGKTTLALSLARTYALSGVPTLLIDCDLRKPGVHQQLGIAPSSGLLDY
                                 GKT                 LLIDCDLR                   
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAKGSDAPELTSIMVADDESGAQVIPGSRRSDIPTDQLLASASFARLVKAAQRSFDIVILDTAPVGPVVDSLYIAPLADV
LAKGSDAPELTSIMVADDESGAQVIPGSRRSDIPTDQLLASASFARLVKAAQRSFDIVILDTAPVGPVVDSLYIAPLADV
                                                         VILDTAP                
       650       660       670       680       690         
....:....|....:....|....:....|....:....|....:....|....:....
VAFVVRWAATPQQDVKEAMQALSDAKSPGSELVAILSQQRSGIRGYYNKSKYAGYYSDR
VAFVVRWAATPQQDVKEAMQALSDAKSPGSELVAILSQQRSGIRGYYNKSKYAGYYSDR
                                             YYNKSKYAGYY   
© 1998-2020Legal notice