BYKdb

Annotate results for A0A1E3Y5Q0

A0A1E3Y5Q0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E3Y5Q0
DOMAINcd118/302ASAMPGEGKTLTAANLALTLSESYQRKVLLIDGDLRKPSQHAVFGLPVSPGLTEGVVGTD
AALSLHRVSPTLTVITAGEPTDDPMVTLAAERMQALITEAREQFDWIVIDTPPVGLLPDA
GLISGLADGTVVVVRADATQYDFVQRSIAELGRERILGVVLNLATPPTDVRYGANYGRYA
ERTSP
SITEWalker A125/127GKT
SITEWalker A'146/153LLIDGDLR
SITEWalker B224/230IVIDTPP
SITEY Cluster289/296YGANYGRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRRAAEARQPISPDAGDAAGGPTVGWPAAPAPVEAFSSEGAERPRPRPVTTVPEILPSRPPASGAPSSPVGERIAADLAN


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KIVVDSGMDAGSREQYRRMAATLHALQAESGLRVITVASAMPGEGKTLTAANLALTLSESYQRKVLLIDGDLRKPSQHAV
                                     ASAMPGEGKTLTAANLALTLSESYQRKVLLIDGDLRKPSQHAV
                                            GKT                  LLIDGDLR       
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGLPVSPGLTEGVVGTDAALSLHRVSPTLTVITAGEPTDDPMVTLAAERMQALITEAREQFDWIVIDTPPVGLLPDAGLI
FGLPVSPGLTEGVVGTDAALSLHRVSPTLTVITAGEPTDDPMVTLAAERMQALITEAREQFDWIVIDTPPVGLLPDAGLI
                                                               IVIDTPP          
       250       260       270       280       290       300      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
SGLADGTVVVVRADATQYDFVQRSIAELGRERILGVVLNLATPPTDVRYGANYGRYAERTSPPGRR
SGLADGTVVVVRADATQYDFVQRSIAELGRERILGVVLNLATPPTDVRYGANYGRYAERTSP    
                                                YGANYGRY          
© 1998-2020Legal notice