BYKdb

Annotate results for A0A1E3WGM8

A0A1E3WGM8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E3WGM8
DOMAINtad14/201ESVDFGKYIVLLKRSWLKITLFTTLVTVLAALFALSIAPTYQATATLLIESNTSKAVSIE
EVVGIDSTQQEYYLTQFEILKSRRIAERVIAQLNLEQNKEFNPYIEPKQSFKSLVKEKIL
ALPMFKSEEAKVEPTAEELATKVRYAVLANFQSRLYISPIRKTQLVRITFESVDPQLAAD
VANAVGEA
DOMAINcd546/735SSSLPNEGKTTCSINLALAFSKVENTLLIDCDLRKSAVAERFGHKRYKPGLTNHLLMNAS
LDECLFVDERSGLTVLPAGMPTQNPQELLSSERFSQLLHQLAERFDKVIIDTPPALVVSD
SMIVSKITGKVVVVLRASSTRVVTLRNTISRFMSHDVQFEGLLLNQISEGKGKQDYVYGD
YIHHLDKVPQ
SITEWalker A553/555GKT
SITEWalker A'572/579LLIDCDLR
SITEWalker B653/659VIIDTPP
SITEY Cluster721/726YVYGDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKLLSDEKTSIEGESVDFGKYIVLLKRSWLKITLFTTLVTVLAALFALSIAPTYQATATLLIESNTSKAVSIEEVVGIDS
             ESVDFGKYIVLLKRSWLKITLFTTLVTVLAALFALSIAPTYQATATLLIESNTSKAVSIEEVVGIDS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TQQEYYLTQFEILKSRRIAERVIAQLNLEQNKEFNPYIEPKQSFKSLVKEKILALPMFKSEEAKVEPTAEELATKVRYAV
TQQEYYLTQFEILKSRRIAERVIAQLNLEQNKEFNPYIEPKQSFKSLVKEKILALPMFKSEEAKVEPTAEELATKVRYAV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LANFQSRLYISPIRKTQLVRITFESVDPQLAADVANAVGEAYILEGLDARLDATEHASSWISGRMAQLQEQLKRSENALI
LANFQSRLYISPIRKTQLVRITFESVDPQLAADVANAVGEA                                       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EFLAQEKLVDDDDSGIDVQASAVINDLILRLSEVTDRRIQLESAYSTLSSGGSLAITDVSSVPEISKHPQVINLRGLLSN


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKHEQTEFSKTYGPKHEKMIAVSAKRANLEEQLNQLIRQLVGGIGKELQAVRSQERLISRELDKRKQEFQSLTVKKRQYE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALLREEETNRNILNIFLNRQKETTATSDFDSRNARFTDEALVPQFPAKPNKKLIVGLAMIAALLLSISVVLLLDAFNNTI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSIKHCEDRLGIIPLGGIPRLNKFKKRALGSDVFFSEKFMTFNESIRSARTALALANKDNKFITISSSLPNEGKTTCSIN
                                                                 SSSLPNEGKTTCSIN
                                                                        GKT     
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LALAFSKVENTLLIDCDLRKSAVAERFGHKRYKPGLTNHLLMNASLDECLFVDERSGLTVLPAGMPTQNPQELLSSERFS
LALAFSKVENTLLIDCDLRKSAVAERFGHKRYKPGLTNHLLMNASLDECLFVDERSGLTVLPAGMPTQNPQELLSSERFS
           LLIDCDLR                                                             
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLLHQLAERFDKVIIDTPPALVVSDSMIVSKITGKVVVVLRASSTRVVTLRNTISRFMSHDVQFEGLLLNQISEGKGKQD
QLLHQLAERFDKVIIDTPPALVVSDSMIVSKITGKVVVVLRASSTRVVTLRNTISRFMSHDVQFEGLLLNQISEGKGKQD
            VIIDTPP                                                             
       730         
....:....|....:....
YVYGDYIHHLDKVPQAQQS
YVYGDYIHHLDKVPQ    
YVYGDY             

© 1998-2020Legal notice