BYKdb

Annotate results for A0A1E3V7R2

A0A1E3V7R2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E3V7R2
DOMAINtad1/81MRDNTTYVESQIAFLRSASLLQKVVDSEKLAEDENIGGSALEWLKGALEVSRIGLADVIE
LTVTSHDPKQATALANAIAQA
DOMAINcd429/616TSAMPNEGKTTLALSLAYSAAADGERVLVVDADLRISAATEFFGMREEVGLVDLLTLPVD
CAKAIHLDERSGIHVLPAGARTLNPPALLASMRMRAVLEELRSAYDTVIIDAPPVGPAAD
ASILGRHVDKTVFVVKWRETSREAVAEGIRHLGGRSKIAGIALTMVDEPKLPKYGRYVSL
EGNVSDRY
SITEWalker A436/438GKT
SITEWalker A'456/463LVVDADLR
SITEWalker B536/542VIIDAPP
SITEY Cluster602/617YGRYVSLEGNVSDRYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRDNTTYVESQIAFLRSASLLQKVVDSEKLAEDENIGGSALEWLKGALEVSRIGLADVIELTVTSHDPKQATALANAIAQ
MRDNTTYVESQIAFLRSASLLQKVVDSEKLAEDENIGGSALEWLKGALEVSRIGLADVIELTVTSHDPKQATALANAIAQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AYVVDRIESRYEGAKKASTWLSERAAVLREELSRSEDAVQKFRMENNLLATRSGSLTEQQLSELNIALINARAESATKRS
A                                                                               

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFEQAEKLLQTGGDTQTIPDVLQSVVVTALRSQHALVTRKEADLLLRYGERHPEVMTAQAERRDVEEQIAAEIQRLIGNL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KNELEAAEAREMALARALSSVSNQSEIEDQVGVRLRDLERIAAANKELFETFLARAKIAEEKSTLLNSGVRVITRAEVPN


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPSFPNRPLFGALGLVFGVALGGAGALLRELFSSGFMAKRQVEEVLAVPVLASLPRMTDWTGAGKAKAQPVAYLERKPLS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYSEAVRRLRLGIDGTAEAEVPPRLMLITSAMPNEGKTTLALSLAYSAAADGERVLVVDADLRISAATEFFGMREEVGLV
                            TSAMPNEGKTTLALSLAYSAAADGERVLVVDADLRISAATEFFGMREEVGLV
                                   GKT                 LVVDADLR                 
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLLTLPVDCAKAIHLDERSGIHVLPAGARTLNPPALLASMRMRAVLEELRSAYDTVIIDAPPVGPAADASILGRHVDKTV
DLLTLPVDCAKAIHLDERSGIHVLPAGARTLNPPALLASMRMRAVLEELRSAYDTVIIDAPPVGPAADASILGRHVDKTV
                                                       VIIDAPP                  
       570       580       590       600       610         
....:....|....:....|....:....|....:....|....:....|....:....
FVVKWRETSREAVAEGIRHLGGRSKIAGIALTMVDEPKLPKYGRYVSLEGNVSDRYYLN
FVVKWRETSREAVAEGIRHLGGRSKIAGIALTMVDEPKLPKYGRYVSLEGNVSDRY   
                                         YGRYVSLEGNVSDRYY  
© 1998-2020Legal notice