BYKdb

Annotate results for A0A1E3GE91

A0A1E3GE91 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E3GE91
DOMAINtad1/228MDADAGSGSGSLSSVISGELPSILGTSQTNAKAQTEVNLIQSRSVLEPVIKSLHLDVVAE
PDYFPVIGKGLAHRYDATNYSNEYASPPLWLSSFAWGGESIDIGQFEVSEPLKSSATISN
TFTLVNLGQGRYELYDPKNRMLGKGEVGKPFAKQLNSFTRVYLLVNSLQSPVGVKFKLKE
LHMMDALKAVSKKLTVGLAGKETPLINLGYTSYSPEKTAEILDAIADQ
DOMAINcd506/694SGPCPNVGKTFVSVNLAHVLSETGQRVLVIDGDLRRGSMHDYFGLSREHGLVDVLEGKLT
TEQAVHKTHIDNLDMMPTGALVAKHAELLMSNKLGEALEQLSSSYDVVVIDTAPILAITD
ASLVAQYAGTNIAVFADAMHDDKEIELTIHRFEKAGVKLAGFIFNNMQLATTTLSNKYKY
AYRYEPRKN
SITEWalker A513/515GKT
SITEWalker A'533/540LVIDGDLR
SITEWalker B613/619VVIDTAP
SITEY Cluster683/689YKYAYRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDADAGSGSGSLSSVISGELPSILGTSQTNAKAQTEVNLIQSRSVLEPVIKSLHLDVVAEPDYFPVIGKGLAHRYDATNY
MDADAGSGSGSLSSVISGELPSILGTSQTNAKAQTEVNLIQSRSVLEPVIKSLHLDVVAEPDYFPVIGKGLAHRYDATNY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNEYASPPLWLSSFAWGGESIDIGQFEVSEPLKSSATISNTFTLVNLGQGRYELYDPKNRMLGKGEVGKPFAKQLNSFTR
SNEYASPPLWLSSFAWGGESIDIGQFEVSEPLKSSATISNTFTLVNLGQGRYELYDPKNRMLGKGEVGKPFAKQLNSFTR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VYLLVNSLQSPVGVKFKLKELHMMDALKAVSKKLTVGLAGKETPLINLGYTSYSPEKTAEILDAIADQAVRQDIYRKSEQ
VYLLVNSLQSPVGVKFKLKELHMMDALKAVSKKLTVGLAGKETPLINLGYTSYSPEKTAEILDAIADQ            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAKTLSFLNKRIPSVQQSVYQAEKALNDYRAKSGNVSLTDETKLVMKTITDLETKIYDLRVQKAQLLQQFTERSVQVEQA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTSIAALEAQLRSLNIRLKSLPQADQVAVNLVRNAKVQNAIYTNLMEKIQQFELLKAGTVGDLSIIDYANVPYKKSNKSG


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AIIVILAGLMGFFLSVAYVFIRKALFQGIEDPDIIENRHGLSVLGTLLASKAQEHQIKEFKKNKVMQLKLLSELDPMDMT


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VEALRSLRTNLTFELAAAKNNIINISGPCPNVGKTFVSVNLAHVLSETGQRVLVIDGDLRRGSMHDYFGLSREHGLVDVL
                         SGPCPNVGKTFVSVNLAHVLSETGQRVLVIDGDLRRGSMHDYFGLSREHGLVDVL
                                GKT                 LVIDGDLR                    
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGKLTTEQAVHKTHIDNLDMMPTGALVAKHAELLMSNKLGEALEQLSSSYDVVVIDTAPILAITDASLVAQYAGTNIAVF
EGKLTTEQAVHKTHIDNLDMMPTGALVAKHAELLMSNKLGEALEQLSSSYDVVVIDTAPILAITDASLVAQYAGTNIAVF
                                                    VVIDTAP                     
       650       660       670       680       690    
....:....|....:....|....:....|....:....|....:....|....
ADAMHDDKEIELTIHRFEKAGVKLAGFIFNNMQLATTTLSNKYKYAYRYEPRKN
ADAMHDDKEIELTIHRFEKAGVKLAGFIFNNMQLATTTLSNKYKYAYRYEPRKN
                                          YKYAYRY     
© 1998-2020Legal notice