BYKdb

Annotate results for A0A1E3G3X8

A0A1E3G3X8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E3G3X8
DOMAINtad8/160EELTFEDILRIFKKRFWWFLGTLVLTIAITVIYLMVATPIYEASVTLKIEPQTKSSLTDL
FVSQYTYTRPEISTEVELIKSRSNLEKVIENLNLVEYYKTKFPGSNMDIYSLAKMLSNMI
TVSPVKDTSIVRIAVQNPDPELAKNIANELAKV
DOMAINcd523/710TSAGPGEGKTFLAANIAISYAQNGLRTLVLDLDMRKPRVEKVFGIERAHAGIVNHILKNA
PIEDITIKYMENLDIIPVGPIPPNPTALLTSKKMEEILQIFKERYDRIVVDLPPVLAAAD
AVIVSKYIDCLVLTVRAGKTQKPSLRVAYENIVTSASKLLGAVINGIGEKHMGYYYYYYY
YYTQDGKR
SITE-660/-662GKT
SITEWalker A'550/557LVLDLDMR
SITEWalker B630/636IVVDLPP
SITEY Cluster696/704YYYYYYYYY
SITEWalker A530/532GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDGEIVREELTFEDILRIFKKRFWWFLGTLVLTIAITVIYLMVATPIYEASVTLKIEPQTKSSLTDLFVSQYTYTRPEIS
       EELTFEDILRIFKKRFWWFLGTLVLTIAITVIYLMVATPIYEASVTLKIEPQTKSSLTDLFVSQYTYTRPEIS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEVELIKSRSNLEKVIENLNLVEYYKTKFPGSNMDIYSLAKMLSNMITVSPVKDTSIVRIAVQNPDPELAKNIANELAKV
TEVELIKSRSNLEKVIENLNLVEYYKTKFPGSNMDIYSLAKMLSNMITVSPVKDTSIVRIAVQNPDPELAKNIANELAKV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YNELLQKFSKSEYTVRREFIEEQIPKLESELKQLEDELRKFKEKHGIYVLNVEVQNLLNTVYNFDNQINQYKIQLEETRA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KIVALNEQLKRTNQKIVSSETISINPVVSQLRSKLAELQVELAALLNNYSENDQRVRDTRKKIEETEKMLRNEVEKIVTA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVQTLNPDYQNIYSQLIEAHAKYEMINSTIAAVERMREKYTAKVAQLPAVEQQLLQLERDRKVKESLYSLLLEKLEETRI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEAGVIGRATIVDPAITPTVPVKPNKRLLLAVASVLGFFLGIMVIFMVESLDKTITDEEYIKHLLKDKPILGRIPEIQFP


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGSEHPELVVLNSPTSPGAESLKLVSTNIEYSDTVPPKAVGITSAGPGEGKTFLAANIAISYAQNGLRTLVLDLDMRKPR
                                          TSAGPGEGKTFLAANIAISYAQNGLRTLVLDLDMRKPR
                                                 GKT                 LVLDLDMR   
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VEKVFGIERAHAGIVNHILKNAPIEDITIKYMENLDIIPVGPIPPNPTALLTSKKMEEILQIFKERYDRIVVDLPPVLAA
VEKVFGIERAHAGIVNHILKNAPIEDITIKYMENLDIIPVGPIPPNPTALLTSKKMEEILQIFKERYDRIVVDLPPVLAA
                                                                     IVVDLPP    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADAVIVSKYIDCLVLTVRAGKTQKPSLRVAYENIVTSASKLLGAVINGIGEKHMGYYYYYYYYYTQDGKRKKKVSRRRKQ
ADAVIVSKYIDCLVLTVRAGKTQKPSLRVAYENIVTSASKLLGAVINGIGEKHMGYYYYYYYYYTQDGKR          
                                                       YYYYYYYYY                
       730         
....:....|....:....
INQTKKVLGGLINDLLKRK


© 1998-2020Legal notice