BYKdb

Annotate results for A0A1E3EVX2

A0A1E3EVX2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E3EVX2
DOMAINtad23/198LAETFDAFVTYLLRQYWVILGTAGLCLFGGICYLMTAAPSYTALATMIIDTRKFQAFQQQ
SPVSEAPVDSAAVESQVEILKSENVALAVIRDLKLNEDPEFVGSRAGAVGAVVDFVSGLL
AGGAPPTEFDRTRRAVRTFQKQLDVRRRGMTYVIEVSFRSLDPERAAQIANAVADA
DOMAINcd560/750TSALPNEGKSTLAFVFAQLVAQSGARVLLIDCDLRNPSLSRKVAATAERGILDVLSNNAT
LQDTLWRDPETGLAFLPGATRSRIAHSHDVLASDQMRDFIDGARSHYDYVIVDFPPLTPV
VDVRITAHFVDSFVFIVEWGKTQVQVVERALRSARAVNENLLGVVLNKADIAAMSRYSGY
GGKNYYYNSHY
SITEWalker A567/569GKS
SITEWalker A'587/594LLIDCDLR
SITEWalker B669/675VIVDFPP
SITE-666/-668YDY
SITE-699/-701GKT
SITEY Cluster736/755YSGYGGKNYYYNSHYGRYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLQRNQISPSVDLRNRPAELPSLAETFDAFVTYLLRQYWVILGTAGLCLFGGICYLMTAAPSYTALATMIIDTRKFQAFQ
                      LAETFDAFVTYLLRQYWVILGTAGLCLFGGICYLMTAAPSYTALATMIIDTRKFQAFQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQSPVSEAPVDSAAVESQVEILKSENVALAVIRDLKLNEDPEFVGSRAGAVGAVVDFVSGLLAGGAPPTEFDRTRRAVRT
QQSPVSEAPVDSAAVESQVEILKSENVALAVIRDLKLNEDPEFVGSRAGAVGAVVDFVSGLLAGGAPPTEFDRTRRAVRT

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FQKQLDVRRRGMTYVIEVSFRSLDPERAAQIANAVADAYIVDQLDSKYQATRRASVWLQDRIQELRTQASNAERAVLDYK
FQKQLDVRRRGMTYVIEVSFRSLDPERAAQIANAVADA                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTNNIVTSSGKLLNEQQLGELNTQLLHVKSQVTDAKAKLDRIEAVVKGGVPDATVADTLNNQVITKLRSQYLELANREAD


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WSSRYGYNHLAAVNLRNQMREIQSSIVDELKRLAESYKSDYAIALQRQNEIERAVNDSVSQSQSTNQAQVTLRELESSAQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TYRSLYDNFLQRYMENVQQQSFPVSEARVITRASRPLGKSHPQTLVVLALSALGGLIAGLGLGVLRDLYDRVFRTAEMVE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TILEADCVAIVPRVSPGQIKAPVAGRPNLPIGPRTIRRGDEPVLWAAIDSPFSRFSEAIRSIKVNADLNVTKPSKILGLT
                                                                               T

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SALPNEGKSTLAFVFAQLVAQSGARVLLIDCDLRNPSLSRKVAATAERGILDVLSNNATLQDTLWRDPETGLAFLPGATR
SALPNEGKSTLAFVFAQLVAQSGARVLLIDCDLRNPSLSRKVAATAERGILDVLSNNATLQDTLWRDPETGLAFLPGATR
      GKS                 LLIDCDLR                                              
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SRIAHSHDVLASDQMRDFIDGARSHYDYVIVDFPPLTPVVDVRITAHFVDSFVFIVEWGKTQVQVVERALRSARAVNENL
SRIAHSHDVLASDQMRDFIDGARSHYDYVIVDFPPLTPVVDVRITAHFVDSFVFIVEWGKTQVQVVERALRSARAVNENL
                            VIVDFPP                                             
       730       740       750       
....:....|....:....|....:....|....:..
LGVVLNKADIAAMSRYSGYGGKNYYYNSHYGRYGYTE
LGVVLNKADIAAMSRYSGYGGKNYYYNSHY       
               YSGYGGKNYYYNSHYGRYGY  

© 1998-2020Legal notice