BYKdb

Annotate results for A0A1E3BVC3

A0A1E3BVC3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E3BVC3
DOMAINtad7/141LEIDIREMVYLLLKKWYLIVLCFVLAAGSAFVVTQFYIKPIYKAETTLFLGKEKDQVSLS
FADIQVNNQLVVDYREILQSRRVAEIINQKFGVGISEFQNNVNVKTVKDSRLFSISYEDT
DPKRAADVVNELASV
DOMAINcd282/463TSPTLGDGKTVTAVNLAVTLARSGKKVLVIDADLRKPKVHHYFGVKNKEGLTNILTDSKE
DIKVKPTEKSDISNLYIITSGPIPPNPAEMLNSNRMKKLLEKMKEEYDIIIIDTPPVGQV
TDAAIVAGITDGVMLVLASGQTRIEMAKRATKSLESVKARFVGAVLTKLDTERTGYYSYK
YE
SITEWalker A289/291GKT
SITEWalker A'309/316LVIDADLR
SITEWalker B391/397IIIDTPP
SITEY Cluster457/462YYSYKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKDDILEIDIREMVYLLLKKWYLIVLCFVLAAGSAFVVTQFYIKPIYKAETTLFLGKEKDQVSLSFADIQVNNQLVVDY
      LEIDIREMVYLLLKKWYLIVLCFVLAAGSAFVVTQFYIKPIYKAETTLFLGKEKDQVSLSFADIQVNNQLVVDY

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REILQSRRVAEIINQKFGVGISEFQNNVNVKTVKDSRLFSISYEDTDPKRAADVVNELASVIQKMADEIIQVKNIKVIDT
REILQSRRVAEIINQKFGVGISEFQNNVNVKTVKDSRLFSISYEDTDPKRAADVVNELASV                   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKIPENPIKPNKKMNVGAAGLFGLVLGVGLIFLLELIDHTFKKPEEVERTLGINVIGTIPEFEGGKRGKKKAKDEKELQE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QYLKNLIVHNNPKATSAEAFRELRTNLYYSSVDREIKTIVVTSPTLGDGKTVTAVNLAVTLARSGKKVLVIDADLRKPKV
                                         TSPTLGDGKTVTAVNLAVTLARSGKKVLVIDADLRKPKV
                                                GKT                 LVIDADLR    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HHYFGVKNKEGLTNILTDSKEDIKVKPTEKSDISNLYIITSGPIPPNPAEMLNSNRMKKLLEKMKEEYDIIIIDTPPVGQ
HHYFGVKNKEGLTNILTDSKEDIKVKPTEKSDISNLYIITSGPIPPNPAEMLNSNRMKKLLEKMKEEYDIIIIDTPPVGQ
                                                                      IIIDTPP   
       410       420       430       440       450       460   
....:....|....:....|....:....|....:....|....:....|....:....|...
VTDAAIVAGITDGVMLVLASGQTRIEMAKRATKSLESVKARFVGAVLTKLDTERTGYYSYKYE
VTDAAIVAGITDGVMLVLASGQTRIEMAKRATKSLESVKARFVGAVLTKLDTERTGYYSYKYE
                                                        YYSYKY 
© 1998-2020Legal notice