BYKdb

Annotate results for A0A1E3A154

A0A1E3A154 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E3A154
DOMAINcd40/232TSSTPNEGKTSVSFQLAISIAEGGKKVILVDADLRKSVLKGRYKSNASRYGLSHYLSGQA
SISEICCKTNIPNFYVIFSGPVPPNPSELLGNDAFELLLEYLRKEYDYVIVDTPPLGSVI
DGAVAAQHCDGTVIVIESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYY
GKYYGKYYGKYYG
SITEWalker A47/49GKT
SITEWalker A'67/74ILVDADLR
SITEWalker B148/154VIVDTPP
SITE-89/-147YGLSHYLSGQASISEICCKTNIPNFYVIFSGPVPPNPSELLGNDAFELLLEYLRKEYDY
SITEY Cluster214/231YYGAYYGKYYGKYYGKYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQTVTFNAIEKLDFRTKESYKTLRTNLEFSGKDRRVISVTSSTPNEGKTSVSFQLAISIAEGGKKVILVDADLRKSVLKG
                                       TSSTPNEGKTSVSFQLAISIAEGGKKVILVDADLRKSVLKG
                                              GKT                 ILVDADLR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYKSNASRYGLSHYLSGQASISEICCKTNIPNFYVIFSGPVPPNPSELLGNDAFELLLEYLRKEYDYVIVDTPPLGSVID
RYKSNASRYGLSHYLSGQASISEICCKTNIPNFYVIFSGPVPPNPSELLGNDAFELLLEYLRKEYDYVIVDTPPLGSVID
                                                                   VIVDTPP      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAVAAQHCDGTVIVIESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYGNDDEGGLH
GAVAAQHCDGTVIVIESGAISYKFAQKVKEQLEKVDCRILGVILNKVNMSGKGYYGAYYGKYYGKYYGKYYG        
                                                     YYGAYYGKYYGKYYGKYY         
       250       260       270       280       290       300        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
AAVVQKGTKAAKAVKGDTGERSHEGKNGSGSGKEKGLEENGYPEDDMIQLDIDMVQLVEDTETIEELK


© 1998-2020Legal notice