BYKdb

Annotate results for A0A1E2URD3

A0A1E2URD3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E2URD3
DOMAINcd95/272SGPKEGCGKTLTSINLCISIARDVNQSVLLVDLDLRRPNIHNYFFTQEVLGISDYLVNKK
NLDEILFNPGIERLVVLPGNKSIQNSSEMLSSPQVVQLVNELKNKYSNRLVIFDMPPLLS
CDDMLAFTPYVDAFMLVVEDGVTLKQDLKRSVELLDTNKLLGIVLNKSKDSVGINQYY
SITEWalker A102/104GKT
SITEWalker A'123/130LLVDLDLR
SITEWalker B205/211VIFDMPP
SITEY Cluster271/272YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKIKDALDKAKKIQSSSRNIKGQNIISSDNRNYLDLENINYTKTKKVKVSEELLRNKRILIGDVKDEISDEYKVLRTQV


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IQLMNKNNWSTLAISGPKEGCGKTLTSINLCISIARDVNQSVLLVDLDLRRPNIHNYFFTQEVLGISDYLVNKKNLDEIL
              SGPKEGCGKTLTSINLCISIARDVNQSVLLVDLDLRRPNIHNYFFTQEVLGISDYLVNKKNLDEIL
                     GKT                  LLVDLDLR                              
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FNPGIERLVVLPGNKSIQNSSEMLSSPQVVQLVNELKNKYSNRLVIFDMPPLLSCDDMLAFTPYVDAFMLVVEDGVTLKQ
FNPGIERLVVLPGNKSIQNSSEMLSSPQVVQLVNELKNKYSNRLVIFDMPPLLSCDDMLAFTPYVDAFMLVVEDGVTLKQ
                                            VIFDMPP                             
       250       260       270  
....:....|....:....|....:....|..
DLKRSVELLDTNKLLGIVLNKSKDSVGINQYY
DLKRSVELLDTNKLLGIVLNKSKDSVGINQYY
                              YY
© 1998-2020Legal notice