BYKdb

Annotate results for A0A1E2SNF6

A0A1E2SNF6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1E2SNF6
DOMAINcd1/191MPSEGKSTLSANLAVTIARGGQPVVVVDADMRHPTQGKTFGIPNGAGLSDVLAGRVSLRE
VLQDPDVSLHTHIRVLTAGRTPPNPSELLGSRTMRELLAALSELAVVIVDAPPLLPVTDA
AVLSKSVDGVLLVVNAKRTKIDQLGKALRTLDQAAGKLTGVVLNRVPRRGADAVNYGYYG
AKYGYGYYHDA
SITE-37/-39GKT
SITEWalker A'25/32VVVDADMR
SITEWalker B107/113VIVDAPP
SITEY Cluster176/188YGYYGAKYGYGYY
SITEWalker A5/7GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPSEGKSTLSANLAVTIARGGQPVVVVDADMRHPTQGKTFGIPNGAGLSDVLAGRVSLREVLQDPDVSLHTHIRVLTAGR
MPSEGKSTLSANLAVTIARGGQPVVVVDADMRHPTQGKTFGIPNGAGLSDVLAGRVSLREVLQDPDVSLHTHIRVLTAGR
    GKS                 VVVDADMR                                                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPPNPSELLGSRTMRELLAALSELAVVIVDAPPLLPVTDAAVLSKSVDGVLLVVNAKRTKIDQLGKALRTLDQAAGKLTG
TPPNPSELLGSRTMRELLAALSELAVVIVDAPPLLPVTDAAVLSKSVDGVLLVVNAKRTKIDQLGKALRTLDQAAGKLTG
                          VIVDAPP                                               
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVLNRVPRRGADAVNYGYYGAKYGYGYYHDASLTAGPEAAPAPAATPVPTPAEPDAADRDATDPHSTSGSVPEPVPAEPA
VVLNRVPRRGADAVNYGYYGAKYGYGYYHDA                                                 
               YGYYGAKYGYGYY                                                    
       250
....:....|
NRGRRAARHG


© 1998-2020Legal notice