BYKdb

Annotate results for A0A1E1EZ67

A0A1E1EZ67 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1E1EZ67
DOMAINtad24/193MVAAARRSWAIVRRHRVILFVTMALSVLAGLIFILMATPDYRATASVEVEDVPAGAAGAG
ATQRPNAPGDTESLMQTQLEVLRSRALAEDVARELALVGSRTFFDGMNRKRPEQGAGSLS
QRQVEQETVLKLLQDGLDIDLPGKSRIIQISFTSANPVLSARVANSYADS
DOMAINcd528/707TSAQEGEGKSLTLNALARALAALGKKVLVVDADMRRPVQHRLFGLVPAIGISEVMTGQAR
VEDAVMPTGVAGLSILPCAAIPPNPGELLATPALDGVMSHARESYDTVLIDAPPILGLAD
APLLAAKAQATVLVVEWGRNHHGGLRVAVERLRRAGGSIIGGILTKQQGRAYDYDYHRGG
SITEWalker A535/537GKS
SITEWalker A'555/562LVVDADMR
SITEWalker B635/641VLIDAPP
SITEY Cluster699/703YDYDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MREAVRMIPEEDAMLAREGHPARMVAAARRSWAIVRRHRVILFVTMALSVLAGLIFILMATPDYRATASVEVEDVPAGAA
                       MVAAARRSWAIVRRHRVILFVTMALSVLAGLIFILMATPDYRATASVEVEDVPAGAA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GAGATQRPNAPGDTESLMQTQLEVLRSRALAEDVARELALVGSRTFFDGMNRKRPEQGAGSLSQRQVEQETVLKLLQDGL
GAGATQRPNAPGDTESLMQTQLEVLRSRALAEDVARELALVGSRTFFDGMNRKRPEQGAGSLSQRQVEQETVLKLLQDGL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DIDLPGKSRIIQISFTSANPVLSARVANSYADSLIRTDLKRGFESGVQARRFLLGELEGARADLERAERDLAVYAARVGG
DIDLPGKSRIIQISFTSANPVLSARVANSYADS                                               

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APPPDAKEGGGEEAPVPQGSVTARLAQLNAFRAQASADRIAAAKKWESARLSSVETLPEVLNNGAMQQLMAQRAEARAEL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRQRQFRKDDHPEMREARARLAALDDQAQAMANTIRASLKEQYDVAVHGEKQIASEIRDLERQALVERGRDVQVGIMERQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDTYRLLHDSLLQRYRDMASQAGFQAGRIQPLDRAAVPARPSSPHVGSAMLIASLGGLLLGLLLVGLRHVFDDAVTSAET


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LGERVGLPMLGSVPVTGDRAQPQEIFSPIASSLLLGSVEGLPRSILVTSAQEGEGKSLTLNALARALAALGKKVLVVDAD
                                               TSAQEGEGKSLTLNALARALAALGKKVLVVDAD
                                                      GKS                 LVVDAD
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRRPVQHRLFGLVPAIGISEVMTGQARVEDAVMPTGVAGLSILPCAAIPPNPGELLATPALDGVMSHARESYDTVLIDAP
MRRPVQHRLFGLVPAIGISEVMTGQARVEDAVMPTGVAGLSILPCAAIPPNPGELLATPALDGVMSHARESYDTVLIDAP
MR                                                                        VLIDAP
       650       660       670       680       690       700       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
PILGLADAPLLAAKAQATVLVVEWGRNHHGGLRVAVERLRRAGGSIIGGILTKQQGRAYDYDYHRGG
PILGLADAPLLAAKAQATVLVVEWGRNHHGGLRVAVERLRRAGGSIIGGILTKQQGRAYDYDYHRGG
P                                                         YDYDY    

© 1998-2020Legal notice