BYKdb

Annotate results for A0A1D9P3V8

A0A1D9P3V8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A1D9P3V8
DOMAINcd41/232TSCTPGEGKTTVAMALARAFAEAGKKTVLVDADMRKSVLVGRYRTGSVRLGLTHCLVGRE
RLSSVICETDTPNLYVIFSGPVPPNPSELLGGRIFSKVLENMKQVFDYVIIDTPPLGSVI
DAAVVSKQCDGTVMVIESNAISYRFAQRVKDQLDKAGAKMLGVVLNKVDISGKGYYGHYG
NYYGKYYGKYYG
SITEWalker A48/50GKT
SITEWalker A'68/75VLVDADMR
SITEWalker B149/155VIIDTPP
SITEY Cluster215/238YYGHYGNYYGKYYGKYYGKYYGKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQTAKLHFSQSENNYQIKEAYKTLRSNIEFSGQNVRVISVTSCTPGEGKTTVAMALARAFAEAGKKTVLVDADMRKSVLV
                                        TSCTPGEGKTTVAMALARAFAEAGKKTVLVDADMRKSVLV
                                               GKT                 VLVDADMR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRYRTGSVRLGLTHCLVGRERLSSVICETDTPNLYVIFSGPVPPNPSELLGGRIFSKVLENMKQVFDYVIIDTPPLGSVI
GRYRTGSVRLGLTHCLVGRERLSSVICETDTPNLYVIFSGPVPPNPSELLGGRIFSKVLENMKQVFDYVIIDTPPLGSVI
                                                                    VIIDTPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAAVVSKQCDGTVMVIESNAISYRFAQRVKDQLDKAGAKMLGVVLNKVDISGKGYYGHYGNYYGKYYGKYYGKYYGKYGD
DAAVVSKQCDGTVMVIESNAISYRFAQRVKDQLDKAGAKMLGVVLNKVDISGKGYYGHYGNYYGKYYGKYYG        
                                                      YYGHYGNYYGKYYGKYYGKYYGKY  
       250       260       270       
....:....|....:....|....:....|....:..
DAEMSSGSGRPKTPEADLPDDDDLDELNYLAGVTRKD


© 1998-2020Legal notice