BYKdb

Annotate results for A0A1D9H5H5

A0A1D9H5H5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1D9H5H5
DOMAINtad19/277RPIDLTECLDVLVRYRWTFLLMVGVIACSGLAYAFLAKPVYRTDILIQVEEGATPSSTAK
LVASVSPALDVKPAAAAEIELLRSRMVVGKAVDSLHLNIEAAPRYFPLLGTAIARYNPVL
SEPGLLGWGGFAWGAEAISVARLDVPVRVEGRPIMVTALASDQFRAELHSEGVTATGTVG
TPLVIPTPGGPVTILISQLDGRPGAKFVVRHIARSVAIDNLQNQLVILERGKQSGVIGIS
LEGSSAERTAAILNAIGTE
DOMAINcd550/737TGPAPDVGKSFVCSNFAAVMASSGRRVVLVDADLRRGGLNHRFSTHRSPGLSEYLAGTAL
DAVLQRDVLPGVDFIATGAQPPQAADLLQSPNMDRLFDLLQASYDIVLLDTPPVLAAADA
GILAARAGAVFLVARADKTTPDELIASQRAIQQAGGEVKGVLFNGLNVDGRWYRAHYRFG
KYRYLNQY
SITEWalker A557/559GKS
SITEWalker A'577/584VLVDADLR
SITEWalker B656/662VLLDTPP
SITEY Cluster722/737YRAHYRFGKYRYLNQY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSTENATGRDYEPTGQDSRPIDLTECLDVLVRYRWTFLLMVGVIACSGLAYAFLAKPVYRTDILIQVEEGATPSSTAKLV
                  RPIDLTECLDVLVRYRWTFLLMVGVIACSGLAYAFLAKPVYRTDILIQVEEGATPSSTAKLV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ASVSPALDVKPAAAAEIELLRSRMVVGKAVDSLHLNIEAAPRYFPLLGTAIARYNPVLSEPGLLGWGGFAWGAEAISVAR
ASVSPALDVKPAAAAEIELLRSRMVVGKAVDSLHLNIEAAPRYFPLLGTAIARYNPVLSEPGLLGWGGFAWGAEAISVAR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDVPVRVEGRPIMVTALASDQFRAELHSEGVTATGTVGTPLVIPTPGGPVTILISQLDGRPGAKFVVRHIARSVAIDNLQ
LDVPVRVEGRPIMVTALASDQFRAELHSEGVTATGTVGTPLVIPTPGGPVTILISQLDGRPGAKFVVRHIARSVAIDNLQ

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQLVILERGKQSGVIGISLEGSSAERTAAILNAIGTEYVDQNVRRKAAEAEKSLEFLETQLPLLKQQVENAESRYNAMRN
NQLVILERGKQSGVIGISLEGSSAERTAAILNAIGTE                                           

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRGTIDLSEESKLVLTQSVQIQTRLQELRQKRQELIARFTPNHPIIAILDGQIASLSSQLNGVTGKIEKLPEVEQDVLRL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRDVKVSTDLYQSLLNDVQQLRLVRASKIGTSRLVDMADVPLYPVRPKRLMIGGAAIVLGLVAGVLAVVLRRTLDGGITD


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADEIERLTGMTVYCTIPFSPQQGRRQGDAPSRGLLARDSPDDPALESLRGFRTALQFALLNSRNRVVLVTGPAPDVGKSF
                                                                     TGPAPDVGKSF
                                                                            GKS 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VCSNFAAVMASSGRRVVLVDADLRRGGLNHRFSTHRSPGLSEYLAGTALDAVLQRDVLPGVDFIATGAQPPQAADLLQSP
VCSNFAAVMASSGRRVVLVDADLRRGGLNHRFSTHRSPGLSEYLAGTALDAVLQRDVLPGVDFIATGAQPPQAADLLQSP
                VLVDADLR                                                        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NMDRLFDLLQASYDIVLLDTPPVLAAADAGILAARAGAVFLVARADKTTPDELIASQRAIQQAGGEVKGVLFNGLNVDGR
NMDRLFDLLQASYDIVLLDTPPVLAAADAGILAARAGAVFLVARADKTTPDELIASQRAIQQAGGEVKGVLFNGLNVDGR
               VLLDTPP                                                          
       730       740     
....:....|....:....|....:
WYRAHYRFGKYRYLNQYGGTGSRQA
WYRAHYRFGKYRYLNQY        
 YRAHYRFGKYRYLNQY        

© 1998-2020Legal notice