BYKdb

Annotate results for A0A1D9G4T2

A0A1D9G4T2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1D9G4T2
DOMAINtad12/157TDAGYGQLLAVLWRRRLWIISVLLTSLPIAFYITLKKEPNYISSLQLLVEPNYIDKTRGI
ESQFTESTVDIDYATQLQLMRSSELIQRAVDLLRDDYPDITVGDIRGSLRLAQVLQGKTE
TKVFQAVYTSNDRIKTQKVLQAIQKV
DOMAINcd543/730TSALSGEGKSTLALGLALSAARLHRRVLLIDVDMRRPRLHQQLGLSNQEGLSTLLEDDTA
TPSPVSISPLGSTIDVLTAGPTPIDPVKLLGSKRMKNLMAEFQQTYDLVLLDTPPVLGMV
DALQAASLCQGVVMVGRLERVTQSQLSQATAILRNLNLMGIIANGVKSSNQNYAYYGSRN
NHAAIEPQ
SITEWalker A550/552GKS
SITEWalker A'570/577LLIDVDMR
SITEWalker B651/657VLLDTPP
SITEY Cluster715/718YAYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKELDLNAAGETDAGYGQLLAVLWRRRLWIISVLLTSLPIAFYITLKKEPNYISSLQLLVEPNYIDKTRGIESQFTESTV
           TDAGYGQLLAVLWRRRLWIISVLLTSLPIAFYITLKKEPNYISSLQLLVEPNYIDKTRGIESQFTESTV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DIDYATQLQLMRSSELIQRAVDLLRDDYPDITVGDIRGSLRLAQVLQGKTETKVFQAVYTSNDRIKTQKVLQAIQKVYQD
DIDYATQLQLMRSSELIQRAVDLLRDDYPDITVGDIRGSLRLAQVLQGKTETKVFQAVYTSNDRIKTQKVLQAIQKV   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YNLEQQEMRLNKGLAFINQQLPTARNNLEQAEQRLEQFRKSKNLIDPSQQALAVSQTLNGIEQERRAIRAQYMETQTRYE


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVQQKLARSPQNALTSSRLSQSGRYQNLLNEIQRIELALVEQSRIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQVPT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLVSTGSNLLTEGQLGGVDINLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQ


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLQARQELSIELARGGFNWQVVEAPLPGFKTGPNMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHSSDDLKNQVALPLLG


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIPELPEGKISKPVLNLSLSQSEKTLPMMELLGWRPFQEALDMIYVNIQLLNSGSEWKSLMVTSALSGEGKSTLALGLAL
                                                              TSALSGEGKSTLALGLAL
                                                                     GKS        
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAARLHRRVLLIDVDMRRPRLHQQLGLSNQEGLSTLLEDDTATPSPVSISPLGSTIDVLTAGPTPIDPVKLLGSKRMKNL
SAARLHRRVLLIDVDMRRPRLHQQLGLSNQEGLSTLLEDDTATPSPVSISPLGSTIDVLTAGPTPIDPVKLLGSKRMKNL
         LLIDVDMR                                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAEFQQTYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRLERVTQSQLSQATAILRNLNLMGIIANGVKSSNQNYAYYGS
MAEFQQTYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRLERVTQSQLSQATAILRNLNLMGIIANGVKSSNQNYAYYGS
          VLLDTPP                                                         YAYY  
       730       740       750   
....:....|....:....|....:....|...
RNNHAAIEPQQPVSDLQESPQLERQFSNHVKSR
RNNHAAIEPQ                       

© 1998-2020Legal notice