BYKdb

Annotate results for A0A1D9G1F2

A0A1D9G1F2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A1D9G1F2
DOMAINtad1/149MDTSLSSLPLALKRRLLPALVTFTSVIGGAIAYLVVTPPVYQVKARLMLDNKKVSVSELG
DNLSQVPANTPGGADPIATQAELVGSERLLQGALDEIALLGSSQEGLTIDTLREDLKVKI
VPATNILELSYQGQNPELVTTVLNAVANA
DOMAINcd520/707SSAVSGEGKSVVASHLGAVSVRFSRRTLIIDADWRHPMQQDLFGLSPQPKVTDVIDSNQT
WLSAVQPTAIPNLSILTCSDLPSGPATFLQSQVIKSILAAAADHYDLVIVDTPPVSSFPD
AHTLSRYSDGLVMVTRPNFTQKDILLQTVSELNDSSTPILGFVVNGISDRTQQYYSDSFY
SYQPQSQS
SITEWalker A527/529GKS
SITEWalker A'547/554LIIDADWR
SITEWalker B627/633VIVDTPP
SITEY Cluster693/701YYSDSFYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDTSLSSLPLALKRRLLPALVTFTSVIGGAIAYLVVTPPVYQVKARLMLDNKKVSVSELGDNLSQVPANTPGGADPIATQ
MDTSLSSLPLALKRRLLPALVTFTSVIGGAIAYLVVTPPVYQVKARLMLDNKKVSVSELGDNLSQVPANTPGGADPIATQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AELVGSERLLQGALDEIALLGSSQEGLTIDTLREDLKVKIVPATNILELSYQGQNPELVTTVLNAVANAMVTESAEGIRS
AELVGSERLLQGALDEIALLGSSQEGLTIDTLREDLKVKIVPATNILELSYQGQNPELVTTVLNAVANA           

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EARAVREFLEKEVPLRRLEVAAAEAALNKFKQTTGLVSPEEQTQLLVRSLATLEDQERAVSIQLQDAKTRSQELQTITSL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNTQNAYIAGRIGQDQELQALRAQLVELDRELAKMRSRLTDQNPAVISLVQERYELLTLYNQKLSRLLPTNQSNNQIIAP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDVASDQLSQDFTSRFILAETERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEARI


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEAQLVSNIQIIERAKLPSSPKEPNPKVVLVIATAAGIALAVGMVLLLEVMDNTLHDASEAEALLKLPRLGVLPKIPAQA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSLEQPNRFLEDMRLMEPYRLLLTTMELRAQKRLQLIVVSSAVSGEGKSVVASHLGAVSVRFSRRTLIIDADWRHPMQQD
                                       SSAVSGEGKSVVASHLGAVSVRFSRRTLIIDADWRHPMQQD
                                              GKS                 LIIDADWR      
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LFGLSPQPKVTDVIDSNQTWLSAVQPTAIPNLSILTCSDLPSGPATFLQSQVIKSILAAAADHYDLVIVDTPPVSSFPDA
LFGLSPQPKVTDVIDSNQTWLSAVQPTAIPNLSILTCSDLPSGPATFLQSQVIKSILAAAADHYDLVIVDTPPVSSFPDA
                                                                  VIVDTPP       
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HTLSRYSDGLVMVTRPNFTQKDILLQTVSELNDSSTPILGFVVNGISDRTQQYYSDSFYSYQPQSQSRQTHGNEASNNCA
HTLSRYSDGLVMVTRPNFTQKDILLQTVSELNDSSTPILGFVVNGISDRTQQYYSDSFYSYQPQSQS             
                                                    YYSDSFYSY                   
       730 
....:....|.
VVSKGVDHADS


© 1998-2020Legal notice